KEGG   Cryptococcus neoformans var. neoformans JEC21: CNJ00950Help
Entry
CNJ00950          CDS       T00243                                 

Definition
(RefSeq) pyruvate decarboxylase, putative
  KO
K01568  pyruvate decarboxylase [EC:4.1.1.1]
Organism
cne  Cryptococcus neoformans var. neoformans JEC21
Pathway
cne00010  Glycolysis / Gluconeogenesis
cne01100  Metabolic pathways
cne01110  Biosynthesis of secondary metabolites
cne01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:cne00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CNJ00950
Enzymes [BR:cne01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.1  pyruvate decarboxylase
     CNJ00950
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TPP_enzyme_N TPP_enzyme_M TPP_enzyme_C MR_MLE_C DXP_synthase_N E1_dh
Motif
Other DBs
NCBI-GeneID: 3254106
NCBI-ProteinID: XP_567475
UniProt: Q5KAP7
Position
10:join(274402..274508,274569..274632,274717..274805,274860..274932,274981..275232,275295..275586,275636..276070,276122..276324,276381..276737)
Genome map
AA seq 623 aa AA seqDB search
MSDNEQVAFFTYILERLKQCGVKQIFGVPGDFNLTALDYIEKDPELQWVGNANELNAAYA
SDGYARVKGTLAVVITTFGVGELSALCGIAGCLSERVPVLHIVGAPSTSLQAKQSLLHHT
LNLPESFSTFSSMSAPLSCSQALINNIEPKTPTSWTEAFDKTLKAVLEQCRPGYVEVPTD
AVHAKVSAEGLKQPLPPPHSAPPPESMGTSLSNTSASAASRGAAQVSLSTAPTNVPSAPS
SDDVTAHVVEDITKRFGEAKKPIILVDACAGRFGMAIEVRKLVDACGIRFFETPMGKSLM
DERHPLYGGCYAGANSLPTVQKEVESADFVLYVGALKSDFNSGSFSVNIDPKVIVELHSF
TTTIGYASYPTTDIRTILPLLRPAFEKLGRGKQSEGQSVEQKVEDKSVDSPVVPDPKGDE
IKHEWLWPRVGKWFQDTDIIITETGTSSFGLTNVVLPSNSTYIAQILWGAIGWSVGACLG
AAMAAKENGNNRRTVLFVGDGSLQLTLQEIGTMLRRGVHPYIFVLNNDGYEIERQIHGWT
AEYNDIQLYDHQLLLPFLAGKKTKTPYQSYAVHTPQEFSKLLDDEEFNKPDRLRLIEVFM
PRGDAPAGLIRQAKLTAEANDRI
NT seq 1872 nt NT seq  +upstreamnt  +downstreamnt
atgtccgataacgaacaagtagccttcttcacttacatccttgagcgtctcaagcagtgc
ggcgtcaagcagatctttggtgttcccggtgacttcaacttgactgcccttgactatatc
gagaaggacccggaactccaatgggtcggcaacgccaacgagctcaacgctgcctatgct
tctgacggttatgcccgagtgaagggcactttggccgtcgtaatcaccacttttggtgtc
ggtgagctctctgctctctgtggtatcgctggttgtctctccgagcgagtccccgtcctt
cacattgttggtgcccccagcacttctttacaggccaagcagtctcttttgcaccacact
cttaaccttcccgaatcgttcagcaccttctcctcaatgagcgcgcctctctcatgttct
caggccctaattaataacattgagcccaagactcctacttcttggactgaagcattcgat
aagactctcaaggctgtccttgagcagtgtcgacctggttatgtcgaagttcctacagac
gctgttcacgccaaggtttcggccgagggtcttaagcagcccctacctccaccccactct
gctccccctcccgagtctatgggtacttccctctctaacaccagcgcctcagccgcctcc
cgaggcgcggcgcaagtttcgcttagcactgcacccaccaatgttcccagtgctccctcc
tctgacgatgtgacagcccacgttgttgaggatattactaagcgattcggtgaggctaag
aagcctatcatccttgtagatgcttgtgccggcaggttcggtatggctattgaggttaga
aagctggtcgatgcctgtggtatccgattctttgagacgccaatgggtaagagtttgatg
gacgagcgtcacccactctacggaggttgttacgccggtgccaactctcttcctaccgtc
caaaaggaagttgagtctgccgactttgtcctttacgtcggtgccctcaagtccgacttc
aactctggatcattctccgtcaacattgaccccaaggttatcgtcgaacttcactctttc
accaccactatcgggtacgcttcctatcctaccaccgatatcaggaccattttgcctctt
ctcaggcctgcctttgagaagctcggtcggggtaagcaatccgagggtcagagtgttgag
caaaaggttgaggataagagcgtcgacagccctgtggtgcccgatcctaagggtgatgaa
atcaagcacgaatggttatggcctcgagttggcaagtggttccaggacactgatatcatc
atcaccgagactggtacttcctcctttggcctcaccaacgtcgtcctcccttcaaattct
acttacattgcccaaatcctttggggtgccatcggttggtccgtcggtgcttgtctcggt
gccgccatggcagccaaggagaacggtaacaaccgaaggaccgtcttgtttgtcggtgac
ggttctttgcagttgacacttcaggagattggtaccatgctccgccgaggcgtccatcct
tacattttcgtcctcaacaacgatggctacgaaattgagcgacagatccacggctggacc
gccgagtacaacgacattcagctctacgaccaccaactcctcctccccttccttgctggt
aagaagactaagaccccttatcagtcttacgcagtccacactcctcaagagtttagcaaa
cttctcgatgatgaagagttcaacaagcccgacaggttgaggttgatcgaagtgtttatg
cctaggggtgatgctcctgctggtcttatcaggcaggccaaattgaccgccgaggccaat
gacaggatctaa

DBGET integrated database retrieval system