KEGG   Cryptococcus neoformans var. neoformans JEC21: CNK00060Help
Entry
CNK00060          CDS       T00243                                 

Definition
(RefSeq) beta-fructofuranosidase
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
cne  Cryptococcus neoformans var. neoformans JEC21
Pathway
cne00052  Galactose metabolism
cne00500  Starch and sucrose metabolism
cne01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cne00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    CNK00060
   00500 Starch and sucrose metabolism
    CNK00060
Enzymes [BR:cne01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     CNK00060
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C
Motif
Other DBs
NCBI-GeneID: 3254668
NCBI-ProteinID: XP_567775
UniProt: Q5KA05
Position
11:join(17134..17298,17354..17420,17470..18596,18705..18905)
Genome map
AA seq 519 aa AA seqDB search
MFRSLVPVTIAGLAYVLQSLAQSTTSSAASVPTGVPIDGDYSGPYRPRVHFSPPKGFMND
PNGLHKDGNGTWHLYYQYNPTDIVAGNQHWGHATSPDLYHWTNQPIALFPPNSSSGVFSG
SAVIDTNNTSGFFPDQDNGVVAIYTLNTPTAQVQQIAYSKDGGYSFEEYEGNPVLDVGLT
QFRDPKVIWYEDHWVMVVAFPVDYVIGVYTSPDLKSWTHASNITHVGFLGLQYECPNMVS
IPIANSSDSSWVLTISINPGSPLGGSITQYFPGEFNGTHFTPYDSAARLTNFGKDDYAGQ
FFYDEPVSIGWASNWQYTNFVPTGEEGWRSAMTLPRKNYFTNITAAGWDLVQEVYDLSPV
LGDQLDTQQLVNKSSTATITEAAYIDVNFTIPDDASFAEYASLNFTVSTNSSGETVKGGY
FFAEPYSIAAWLDRRDTKAFESPFFTDKFSVAPAQQAKRLQVIIDRSLIEIYIDNGALVG
TMVAFPEEPFTKLEVTTAGLPDGMEVEVGVWDLKDSWTS
NT seq 1560 nt NT seq  +upstreamnt  +downstreamnt
atgttccgctccctcgtccccgtcaccatcgccggtctggcatatgtccttcagagtcta
gctcagtccacaacgtcaagtgctgcctctgtccctactggagtccccatcgatggagac
tactctgggccttaccgccccagggttcatttctcacccccaaaaggatttatgaatgat
ccgaacggtctgcacaaggatggcaacggaacttggcatctgtactaccagtataaccca
actgatatcgtggccgggaatcaacactggggccatgccacctctcccgacctctatcat
tggaccaaccagcctatcgccctcttccctcccaattcttcctcgggagtcttttccggt
tcggctgtcattgataccaataatacctctggtttcttccctgatcaggacaatggcgtt
gtagccatttacaccctcaataccccaactgcccaggtccagcagattgcctactctaaa
gatggtggctattccttcgaagagtatgaaggtaaccctgtcttggatgtcggattgact
cagttccgagatcccaaagttatctggtacgaggaccattgggtgatggtcgtcgctttc
cctgtagactacgttattggcgtctacacctctccggacctcaaatcatggacacacgcc
tccaacatcacccacgtcggtttccttggccttcaatacgaatgccctaacatggtgtcc
atcccaatcgccaactcctctgattcctcttgggtactcactatctccattaaccctggt
tcaccacttggcgggtctatcacgcagtatttccccggagagttcaacggtacccacttc
actccctatgattctgctgcgagactcacaaactttgggaaggacgactatgccggtcag
ttcttctatgatgagcctgtcagtattggatgggcatccaactggcagtatacaaacttt
gtaccgacaggcgaagaaggttggaggagtgcgatgacattgccgaggaagaattacttt
acaaacatcactgcagccggatgggatctcgttcaagaagtgtacgacctttctcccgtc
cttggggaccaacttgatacccaacaactcgtcaacaagtcctccactgctactatcact
gaggccgcatacatcgacgtcaactttaccatccctgatgatgcctctttcgcggaatat
gcgtcgctcaacttcaccgtttctacgaacagctcaggcgagacggtgaaagggggttac
ttttttgcggaaccttattccatcgccgcatggctcgataggagagacacaaaggcgttt
gaaagtccttttttcaccgacaagttctcggtagctccagctcaacaagcaaaaagactc
caagtcatcatcgatcgcagcctaatcgagatctacattgataatggtgcattggtgggc
accatggttgcttttccagaggagccattcacaaaacttgaggttacgacggccggtttg
ccggatggcatggaggtagaggtgggggtttgggatttgaaagatagttggacatcatga

DBGET integrated database retrieval system