KEGG   Cryptococcus neoformans var. neoformans JEC21: CNL04840Help
Entry
CNL04840          CDS       T00243                                 

Definition
(RefSeq) exo-beta-1,3-glucanase
  KO
K01210  glucan 1,3-beta-glucosidase [EC:3.2.1.58]
Organism
cne  Cryptococcus neoformans var. neoformans JEC21
Pathway
cne00500  Starch and sucrose metabolism
cne01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cne00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    CNL04840
Enzymes [BR:cne01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.58  glucan 1,3-beta-glucosidase
     CNL04840
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cellulase
Motif
Other DBs
NCBI-GeneID: 3254767
NCBI-ProteinID: XP_568025
UniProt: Q5K8Q7
Position
12:join(358681..358959,359068..359345,359394..359643,359703..359805,359853..359995,360044..360239,360287..360960,361020..361128,361180..361271,361326..361685)
Genome map
AA seq 827 aa AA seqDB search
MPRPSYDPVANPNFSPDSNISPDPNRNSSFLDPEANNLFGRPGSEYAPAPSLMSRDSTAA
SMNLAGGTPSLAGTHRDSWGSGVGLTGAEGATNGNRNPGRSGLAHSTVAYESGDRLSTSE
EDDEQGHITPAVAAIGAGTAARGFSEKPRWADHESGQGKKNRKWLWAALAALLIVAIGLG
VGLGVGLTRNKDSKSLVASAGNENSSSQAPSGTSSVSGSTTATSTSATASATPTTGTQGS
LITLEDGSTMTYDNPYGGKWVWDEANPFNNEAQANSWTPALNQNWTWGQDKVFGVNLGGW
LVTEPFIVPGLYEKYANGSAGTAIDEYTLSINMGDNLTDALTEHYETFITERDFVEIVAA
GLNWVRIPIPFFAIEVWEGEPFLPKVSWEYFLKAIKWARKYGLRINLDLHSVPGSQNGWN
HSGRQGSVNWLNGVMGLANAQRSLDYVRTLAQFIAQPEYAPVIQMFGFLNEPNGNAISKG
PVASFYIEAHNIIRDITGIGAGNGPMLSMHDGFLGVAAWYGDLAGADRMMLDQHTYMVFQ
DQPQGTLDTLKTMPCQWWASSTNTTSQQWGPNTAGEWSAAWNDCGKWVNNVGSGSRYDGT
YDGYADKVTGSCDYWNDYTQWNASTIEALNHFVSGSMDALQNFFFWTWKIGNSTDAIQQP
NPFWHYRLGLEKGWIPKDPRTVAGTCQADGVSMNNFDGTFSNAYVTGGAGAGTIAASASS
SYPWPPASFTNVASDSISLLPQYTQTGTPITMPGPTFTSPGSTATISAGSGWYNANANDR
QAYAAISGCSYPAEYSAADLAIPTGACGAGLSQANKRSAQPTPAPTR
NT seq 2484 nt NT seq  +upstreamnt  +downstreamnt
atgccgcgcccatcttatgacccagtggcgaacccaaacttctccccggattccaatatc
tctcccgatcccaaccgtaactccagctttctcgacccagaagcgaacaacctttttggg
aggcccgggtccgaatatgccccagcaccatcgctcatgagccgtgactcaacagcagca
agcatgaatcttgccggggggacaccatctctggctggcacacatagggatagctggggc
agtggagtagggctgactggtgctgaaggagctaccaatggcaaccgtaacccaggtcga
tctggccttgctcattcaactgttgcttatgaaagcggcgatcgattatccaccagcgag
gaggacgacgagcagggccacatcacacccgcggtggcagccattggagcgggaacagca
gcacgaggattcagtgaaaagccaagatgggcagaccacgaatctggccagggaaagaag
aacaggaagtggctgtgggcggctttggcagctttgctgattgttgctatcggcctcggt
gttggccttggtgtcggtctcacccgaaacaaggacagcaaaagcctcgttgcttccgct
ggtaatgaaaattcttcatcccaggctccgtcgggcacatcttccgtatcgggatcaacg
acagctacatcaactagcgccactgcttctgctactcccactaccggcactcaaggctcc
ctcatcactttggaagacggttccacgatgacttatgacaatccctacggcggtaagtgg
gtatgggacgaggccaacccgttcaacaacgaagcccaagccaactcttggaccccggca
ctgaatcaaaactggacatggggtcaagataaagtctttggtgttaacctcggtggttgg
cttgttactgagcccttcatcgtccccggcctttacgaaaagtatgccaacggctctgcc
ggcactgctatcgacgaatacaccctttctatcaacatgggtgacaaccttactgatgcc
ctcacggaacattacgagacattcattaccgagcgtgactttgtcgaaattgtcgctgcg
ggcctcaactgggtgcgaatccctattcccttctttgctatcgaggtctgggagggcgag
ccttttctacccaaggtttcatgggaatactttttgaaagctatcaaatgggccaggaag
tatggattgaggattaaccttgaccttcactctgttcccggttctcaaaacggctggaac
cactctggccgccaaggatccgtcaactggctgaacggtgtcatgggccttgctaacgct
caacgatccctcgactacgtccgtacgctcgcacaattcattgctcagcccgagtacgct
cctgtcatccagatgtttggattcctcaatgaacccaacggcaatgctatcagcaaaggc
cccgtcgcctccttttacattgaggcccacaacattattcgcgacattactggtatcggc
gccggcaacggtccaatgctctccatgcacgatggatttttgggagttgctgcgtggtac
ggcgatcttgctggtgctgaccgtatgatgctcgaccaacacacctacatggtcttccag
gaccagcctcagggtactcttgacactcttaaaacgatgccatgccaatggtgggcttcg
tccaccaacaccacctcccagcagtggggtcccaataccgctggtgaatggtctgcggcc
tggaacgattgcggtaaatgggtgaacaatgttggaagtggatcgagatacgatggaact
tatgatggttatgcggacaaggtgaccggcagctgtgattactggaacgactatacccaa
tggaacgcgagtaccatcgaggcgttgaaccactttgtctctggtagtatggatgctttg
cagaactttttcttctggacttggaagattggaaacagtaccgacgctattcagcagccc
aacccattctggcactaccgtctcggtctcgagaagggatggattcccaaagaccctcga
acggttgctggtacctgccaggcagacggcgtatcgatgaacaactttgacggaacgttc
tccaatgcctacgtgactggtggtgccggtgctggtaccattgcggcgtccgcgtcctct
tcctacccctggccgcctgcttcgttcaccaacgtcgcctcggactccatatctctcctc
cctcaatatacccagacgggtactcctattaccatgcccggacctacatttacctctccc
gggtctactgcgaccatcagcgcgggtagcggatggtataacgcgaatgcgaatgatagg
caggcatatgccgctatcagcgggtgtagctatcctgcagagtattctgcggccgatttg
gctattccgacgggtgcatgtggtgcggggttgagccaggcgaacaagaggtctgctcag
cctactcctgctcctacacgatga

DBGET integrated database retrieval system