KEGG   Cryptococcus neoformans var. neoformans JEC21: CNN02060Help
Entry
CNN02060          CDS       T00243                                 

Definition
(RefSeq) amidase, putative
  KO
K01426  amidase [EC:3.5.1.4]
Organism
cne  Cryptococcus neoformans var. neoformans JEC21
Pathway
cne00330  Arginine and proline metabolism
cne00360  Phenylalanine metabolism
cne00380  Tryptophan metabolism
cne01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cne00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    CNN02060
   00360 Phenylalanine metabolism
    CNN02060
   00380 Tryptophan metabolism
    CNN02060
Enzymes [BR:cne01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.4  amidase
     CNN02060
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-GeneID: 3255519
NCBI-ProteinID: XP_568681
UniProt: Q5K6W3
Position
14:complement(join(644450..644565,644622..644833,644903..645116,645192..645345,645423..645690,645752..645971,646025..646118,646171..646285,646337..646614))
Genome map
AA seq 556 aa AA seqDB search
MLWEEAVSTKRRERESKLPPKWLIPSDQLPPSDVLNVQNVPETLGCLSEREIGITGAGVS
EILSKIASRQWTSREVTEAFAHRTTIAHQLLNPITEVNFETAFSQADYLDEYLAREGKTI
GPLHGLPISCKDSCDVEGLDTTMGYSAWVGSKAKKDCVMIASLRAAGAIPFVKTNLGHTL
MMGETVNHLFGRSLNPWNRSLTPGGSSGGEAALLAFRGSPVGWGTDIGGSIRLPSASTNL
YGLRPSPGRVSYRGLADTFLGQEAVRCVLGPMGQSPSDLELLMSVYMASKPWNNDPDVIP
LEWKKPSDALAERPCCFAYINGDEFVTPHPPIQRALKHVIERLRKAGHQVVEWQGPLAKN
AGRLMLDFWTADGGEEVRHRVAASGEPMIPEVAQLLRMTPESDFVPPTVSQTWRNQHERD
LCARQFLDHWQDSACWSGCGEIIDGLIIPAAPFLARPHGADLPSSKWGVFEHTYADFQPL
FQLSTGSFPSGLFQDPSIDLPLKGFTPRSDLDKVVQALYSDPEEWRGAPIGFQLVGRRLE
EEKVLAMLQQVQKALE
NT seq 1671 nt NT seq  +upstreamnt  +downstreamnt
atgttatgggaagaagccgtctcgacaaaacgcagggaaagggaatcaaaactgccaccc
aaatggctcatcccttcagatcaactaccaccaagcgatgtcctcaatgtccaaaatgta
cctgaaactctaggttgtctctcagaaagggaaatcgggataacaggagccggagtttcg
gaaatcttgagcaaaatcgccagccgccaatggacgtcgagggaagtgactgaagctttt
gcccatcgaaccactattgcccaccagttgctgaatcccattaccgaggtgaattttgag
accgcgttttctcaggcagattaccttgacgaatacctcgctcgagagggaaagacgatc
ggtccattgcacggccttccaatctcatgtaaagattcttgcgacgtagaaggtctcgac
acaaccatgggctactctgcttgggtggggagtaaagctaagaaagattgtgtcatgatt
gcatcattacgagctgcaggagcaatcccatttgtgaaaaccaatctcggtcatacactt
atgatgggcgaaaccgttaaccatttatttggacgatcgctcaatccctggaacagatct
cttacccccggaggcagcagcggcggtgaggcagctcttctcgcttttcgtggaagtcca
gtaggctggggaacagatatcggtggaagcatccggctaccttcagcgtcgactaacctg
tacggtctgcgaccttctcccgggcgagtatcgtatcgcggcttggcggacacattcctc
ggccaagaggccgttcgatgcgtcctggggcccatgggtcagtcaccttctgacctcgaa
ttgctcatgtctgtctacatggcctcaaagccatggaacaacgacccggatgtaatccca
ctcgagtggaagaaaccaagtgatgcgctggccgagagaccttgttgttttgcttatatt
aacggcgacgaattcgtcacaccgcatcctccaatccaacgagctctcaaacatgttatt
gaaagactacgaaaagctgggcaccaagtagtagagtggcaaggtccgctcgccaaaaat
gccggtcgtttgatgctagatttctggactgctgacggtggggaagaagttcgccatcga
gttgctgcctcaggggaacctatgatccctgaagtagcccaactactccgcatgacccca
gaatccgattttgtacccccaactgtcagtcagacatggagaaaccaacatgaacgtgat
ctatgcgccaggcaatttttggatcactggcaagatagtgcctgttggtcaggctgtgga
gagatcattgatggtttaatcattcctgcagccccattccttgctcgacctcatggagca
gatctacccagttccaaatggggagtgtttgaacacacctatgccgactttcaacctctt
ttccaactgtctacaggttcatttccgagtggcctgttccaagatccaagcatcgacttg
ccattgaaagggttcactccaaggagtgacttggataaagtggtacaagccttatattct
gacccagaagaatggcgaggtgcacctattggatttcagctggtaggacgacgattggag
gaggagaaagttctagccatgctgcagcaagtgcaaaaagctctagagtag

DBGET integrated database retrieval system