KEGG   Calditerrivibrio nitroreducens: Calni_0492Help
Entry
Calni_0492        CDS       T01364                                 

Definition
(GenBank) phosphatidylserine decarboxylase related protein
  KO
K01613  phosphatidylserine decarboxylase [EC:4.1.1.65]
Organism
cni  Calditerrivibrio nitroreducens
Pathway
cni00564  Glycerophospholipid metabolism
cni01100  Metabolic pathways
cni01110  Biosynthesis of secondary metabolites
Module
cni_M00093  Phosphatidylethanolamine (PE) biosynthesis, PA => PS => PE
Brite
KEGG Orthology (KO) [BR:cni00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    Calni_0492
Enzymes [BR:cni01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.65  phosphatidylserine decarboxylase
     Calni_0492
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PS_Dcarbxylase
Motif
Other DBs
NCBI-ProteinID: ADR18405
UniProt: E4TF66
Position
complement(508851..509480)
Genome map
AA seq 209 aa AA seqDB search
MIAKEGFSYVTIAGGLFLIVFFLPKWFFTILFFSLTVLFIIFFRDPERDIPIEDGIAVSG
ADGKIVEISEEEIDGEKFKKISVFMNIFNVHVNRVPVDGEVVSVVHKPGKFLSADKKESS
FVNEQNIITIQSKYGKVIVKQVAGFVARRTVSYLQPGDKVKLGDRLGIIKFSSRVDHYLP
ISAKINVDLDDVVYAGETIIARFQVGEEF
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
ttgatagcaaaagaaggcttttcatacgttaccattgctggtggtctttttcttatagta
ttttttctccctaaatggttttttaccattttatttttttctctaacagttttatttatt
atcttttttagagaccccgaaagggatataccgatagaagacggtattgctgtttcgggt
gcggatggtaaaatagtagaaatatcagaagaagagatagatggtgaaaaatttaaaaaa
atatcggtttttatgaatatattcaatgtccatgtaaacagagtacctgtggatggtgaa
gtggtaagtgtggtacataaacccggcaaatttttatccgccgacaaaaaagaaagctct
tttgtaaacgaacagaatatcattacaattcagtcgaaatacggtaaagtaattgttaaa
caggtggctggttttgttgcaagaagaacggtatcatatctccaacctggagataaggta
aagcttggagatagacttggtattataaaattctcttcaagagttgaccactatctaccg
atttctgcaaaaataaatgttgatctggatgatgtagtgtatgcaggtgagacaattata
gcaagatttcaggtgggagaggaattttaa

DBGET integrated database retrieval system