KEGG   Calditerrivibrio nitroreducens: Calni_1238Help
Entry
Calni_1238        CDS       T01364                                 

Definition
(GenBank) L-threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
cni  Calditerrivibrio nitroreducens
Pathway
cni00260  Glycine, serine and threonine metabolism
cni00750  Vitamin B6 metabolism
cni01100  Metabolic pathways
cni01110  Biosynthesis of secondary metabolites
cni01120  Microbial metabolism in diverse environments
cni01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:cni00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Calni_1238
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Calni_1238
Enzymes [BR:cni01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Calni_1238
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thr_synth_N PALP DUF2764 Cache_3-Cache_2 Ntox44
Motif
Other DBs
NCBI-ProteinID: ADR19146
UniProt: E4TJ14
Position
1292125..1293519
Genome map
AA seq 464 aa AA seqDB search
MKYKSTRGKVNQLSFSETVLMGLADDGGLIIPEKIPQIGKEDILRLRDLPYKELALNIMG
YFIDDIPQSDLKKIIDDSYSTFDTEEVIPVVSFGGNLFIGEIFHGPTHAFKDIALQFLGN
LFSFILNQKGQKMNILGATSGDTGSAAIYGFKGKKDINIFILHPHGKVSPVQELQMTTVD
DKNVFNIAIEGTFDDCQFIVKSIFNDLEFKKRYSLGAINSINWSRVLAQIVYYFYTYFKS
TKDNNELPEVYFAVPTGNFGNIFAGFVARKMGLPIKKLILATNENNILTRFINNGDYSLS
KVVETYSPSMDIQIASNLERYLYFLYNEDSGILSEKMKEFEKNRSLSFQGNELKKIQSDF
ISVSTSNDQTLKMIKDFYEKYSYILDPHTACAINAVENVYNSDDIFIALATAHPAKFEDA
IVKAIGIKPEEPSRIKQIKGKPKKFTILKNSIEDVKRFIQETLS
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atgaaatacaaaagtacaagaggtaaagtaaatcagttatcctttagcgaaacagtcctc
atgggacttgcagatgatggtggtttgataataccggaaaagataccacaaattggaaaa
gaagatatattaaggttaagagatctcccctataaagagcttgcattaaatattatggga
tattttatcgacgatatcccccagagtgatctaaaaaaaattatcgatgatagctattcc
acttttgataccgaagaggttatacctgtggtctctttcggaggtaatctttttataggt
gagatcttccacggacctacccacgcatttaaagatatcgctttacaatttttgggcaac
cttttctcttttatactaaatcaaaaagggcagaaaatgaatatccttggggccacaagt
ggtgataccggaagtgctgccatatacggctttaaagggaaaaaagatatcaatatattt
atattacacccccatggaaaggtaagcccggtccaggagcttcagatgactacggtggac
gacaaaaatgtcttcaacatagccatcgaagggacatttgacgattgccagtttatcgta
aaatcgatattcaatgaccttgaatttaaaaaaagatattctttgggggcgataaactct
ataaactggtcaagggtactggcacagatcgtatactatttctacacatattttaaatcc
acaaaagacaacaatgagttgcccgaagtttattttgcagtacctacgggaaattttgga
aatatatttgccggtttcgtagccagaaaaatggggctaccgattaaaaaactgattttg
gccacaaatgaaaataatattttgacgaggtttatcaataatggggattatagcctatca
aaggtagttgaaacctatagcccctcaatggatatccagatcgccagtaaccttgaacga
tatctctattttctttacaacgaagactctgggatactttctgaaaaaatgaaagaattt
gaaaaaaacagatctctttcattccagggtaatgaactcaaaaaaatccagtctgacttc
atatctgtatccacaagcaatgatcaaacactaaaaatgataaaagatttttacgaaaaa
tattcatatattttagatccccataccgcatgtgcgatcaacgcagtggaaaatgtttac
aatagcgatgacatattcatagctcttgccacagctcatcctgctaaatttgaagatgca
atagtaaaagctatagggataaaacctgaagaaccctcaaggataaagcagatcaaaggt
aaaccaaaaaaatttacaatactaaaaaactcaatagaagatgtaaaaagattcatacag
gaaaccttaagttag

DBGET integrated database retrieval system