KEGG   Calditerrivibrio nitroreducens: Calni_1265Help
Entry
Calni_1265        CDS       T01364                                 

Definition
(GenBank) succinate dehydrogenase hydrophobic membrane anchor protein
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
cni  Calditerrivibrio nitroreducens
Pathway
cni00020  Citrate cycle (TCA cycle)
cni00190  Oxidative phosphorylation
cni00650  Butanoate metabolism
cni01100  Metabolic pathways
cni01110  Biosynthesis of secondary metabolites
cni01120  Microbial metabolism in diverse environments
cni01130  Biosynthesis of antibiotics
cni01200  Carbon metabolism
Module
cni_M00009  Citrate cycle (TCA cycle, Krebs cycle)
cni_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
cni_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:cni00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Calni_1265
   00650 Butanoate metabolism
    Calni_1265
  Energy metabolism
   00190 Oxidative phosphorylation
    Calni_1265
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt
Motif
Other DBs
NCBI-ProteinID: ADR19173
UniProt: E4TJA6
Position
complement(1320256..1320576)
Genome map
AA seq 106 aa AA seqDB search
MIKGYKYNGHSDSGLFEWLLQRVSGVILIVVIAVHFFSMIKSGEWGLKSIVLGPLFAFGI
FHTLNGFKMITDDYVKSTIWRAIILAIYWIIGVTAAVLALKVVSGL
NT seq 321 nt NT seq  +upstreamnt  +downstreamnt
atgattaaaggttataaatataatggtcatagcgattcaggtttgtttgaatggctgttg
caaagggtttctggagtaattcttattgtagtaattgcagttcacttcttttctatgata
aaatctggtgagtggggacttaaaagtatcgttttgggtccattatttgctttcggtatt
tttcatacgttgaatggttttaagatgataacagatgattatgttaaatcaactatttgg
agggctataatccttgctatctactggattattggtgttacagcagctgttttggctctc
aaagtagtttctggtctataa

DBGET integrated database retrieval system