KEGG   Calditerrivibrio nitroreducens: Calni_1356Help
Entry
Calni_1356        CDS       T01364                                 

Definition
(GenBank) 3-hydroxybutyrate dehydrogenase
  KO
K00019  3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
cni  Calditerrivibrio nitroreducens
Pathway
cni00072  Synthesis and degradation of ketone bodies
cni00650  Butanoate metabolism
cni01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cni00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    Calni_1356
  Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    Calni_1356
Enzymes [BR:cni01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.30  3-hydroxybutyrate dehydrogenase
     Calni_1356
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR Epimerase 3HCDH_N TrkA_N UPF0146
Motif
Other DBs
NCBI-ProteinID: ADR19264
UniProt: E4TJR8
Position
1416174..1416932
Genome map
AA seq 252 aa AA seqDB search
MKEKVAVVTGASSGIGLSIAEQLSKAGCKVVMADINKEKGIEEANRIGAKFFQVDLSRRS
DCRDLIDFAGNSFGSVDILVNNAGIQHVSPVEDFPEDKWDFMISLMLTAPFLLTKYSWNY
MKEKKWGRIININSVHGLRASEFKSAYISAKHGLSGLTKTTALEGGKYGITVNSICPAYV
RTPLVDNQIDAQAKTHGIPREKVIEEIMLKKAYVKKLIEPSEVGSMVLYLCSDAAQCITG
SMITIDCGWTAS
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaaaaagtagcagtagtaactggtgcctcaagtggtattggattgtcaattgca
gaacaattatcaaaagctggctgtaaggtagttatggcagatataaacaaggagaaaggg
atagaagaagcaaatagaattggtgcaaaattttttcaggtggacttatccagaagatct
gactgcagagatcttatagattttgccgggaatagttttggttctgttgatattctggta
aacaatgccggaatacaacatgtttcgccagttgaagattttccagaagacaagtgggat
tttatgatcagtcttatgttaactgccccatttcttttaacaaaatattcatggaactac
atgaaagagaaaaaatggggaaggattataaacattaattctgtacatggattaagggca
tcagaattcaaatctgcgtatatctcagccaaacatggtttatcaggtcttacaaaaaca
acggcacttgaaggtggaaaatatggaattacggtcaattcgatatgccccgcctacgta
agaactccccttgtggacaatcagatagatgcacaggcaaagactcatggtatcccaagg
gaaaaagtaatagaagagataatgctcaaaaaagcctatgtaaaaaaacttatcgaacct
tcagaagtaggtagtatggtactgtacttatgctcagatgccgcccagtgtattacaggg
tcgatgataacaatagattgtggatggacagcatcttaa

DBGET integrated database retrieval system