KEGG   Calditerrivibrio nitroreducens: Calni_1727Help
Entry
Calni_1727        CDS       T01364                                 

Definition
(GenBank) UDP-N-acetylmuramoylalanine/D-glutamate ligase
  KO
K01925  UDP-N-acetylmuramoylalanine--D-glutamate ligase [EC:6.3.2.9]
Organism
cni  Calditerrivibrio nitroreducens
Pathway
cni00471  D-Glutamine and D-glutamate metabolism
cni00550  Peptidoglycan biosynthesis
cni01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cni00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    Calni_1727
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Calni_1727
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:cni01011]
    Calni_1727
Enzymes [BR:cni01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.9  UDP-N-acetylmuramoyl-L-alanine---D-glutamate ligase
     Calni_1727
Peptidoglycan biosynthesis and degradation proteins [BR:cni01011]
 Precursor biosynthesis
  Amino acid ligase
   Calni_1727
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mur_ligase_M Mur_ligase_C
Motif
Other DBs
NCBI-ProteinID: ADR19633
UniProt: E4TFX7
Position
complement(1781218..1782468)
Genome map
AA seq 416 aa AA seqDB search
MKAAILGYGKSGQTAKRLLEIKGTETIEIYDDKMDGFKGIKDFNYEEFDTVVVSPGIDLT
NIDLPTERITSELELAFEFIKDKKIIGITGTNGKSTVTFLTAQLLKNIGINAEFCGNIGV
TVGDTYLLKNPDVYVVEVSSFQLDLLKRFRFDTSTITNITPDHLDRYKTMDRYITSKSRM
VEFTEGVSFLEKGGWNEIFKKYENIKYVDGELKSYPLLNGNLLEFEDFYVDVNRYNLFGF
HNIVNLSFALLLTNQIVRLKGDVTGLVENLTPLEHRCELVTEINGVKYINDSKGTNVDST
LTALKSSSYPTTLILGGKDKNGDFSVLSDEINKKAKLVICCGAAGEKIYNSLKDIIDVKI
VRVELLKDAISLAYRETKEGTVLFSPACASFDEFNNFEERGRFFKNYVNNLKVRGC
NT seq 1251 nt NT seq  +upstreamnt  +downstreamnt
atgaaggcagcaatattaggatatggaaaaagcggacaaaccgccaaaagattgttggaa
ataaagggaacagaaacgatagaaatatatgatgataagatggatggctttaaggggata
aaagattttaattatgaagaattcgataccgtagtggtaagcccggggatagatttgaca
aatatcgatctacctacagagaggataacgagtgaacttgaacttgcttttgaatttata
aaggataaaaaaataataggtataacaggaactaatggtaaatccactgtaacattttta
actgcacagctattaaaaaatatcggtataaatgccgagttttgtggtaatataggtgtt
actgtgggggatacctaccttttgaaaaatcctgatgtttatgtggtggaggtaagctca
tttcaattggatttactcaaaagattcagatttgatacatctacaattaccaatattact
cccgatcatcttgatagatacaaaactatggatagatacattacatccaaaagcagaatg
gtggagtttacggaaggggtaagttttcttgagaaggggggctggaatgaaatctttaag
aaatatgagaatattaagtatgtagatggtgagctaaagagttatcctttactgaatggt
aatctgcttgaatttgaagatttttatgtggatgtaaatagatataacttatttggattt
cataatatcgtaaacctgagctttgcacttttactgactaatcagatagttagactaaaa
ggagatgtgacgggacttgtggagaatcttactccgcttgagcacagatgtgaacttgtg
acagagataaatggggtaaagtatataaatgattcaaaggggacgaatgtggattccact
ttgacggcacttaaaagctcatcatacccgaccacccttatacttggaggtaaagataaa
aacggtgacttttctgttctttctgatgaaataaacaaaaaagccaaattggtgatctgt
tgtggtgccgccggagagaagatctacaattctctcaaagatattatagatgtaaaaatt
gttagggttgaactgcttaaagatgcaatatcccttgcttacagagaaacgaaagaggga
acggtactattttctcctgcctgtgcaagttttgatgagtttaacaactttgaagaaaga
ggaagattttttaaaaattatgttaacaatttaaaggtgagaggatgttaa

DBGET integrated database retrieval system