KEGG   Calditerrivibrio nitroreducens: Calni_1730Help
Entry
Calni_1730        CDS       T01364                                 

Definition
(GenBank) UDP-N-acetylmuramyl-tripeptide synthetase
  KO
K01928  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
cni  Calditerrivibrio nitroreducens
Pathway
cni00300  Lysine biosynthesis
cni00550  Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:cni00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    Calni_1730
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Calni_1730
Enzymes [BR:cni01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     Calni_1730
Peptidoglycan biosynthesis and degradation proteins [BR:cni01011]
 Precursor biosynthesis
  Amino acid ligase
   Calni_1730
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mur_ligase_M Mur_ligase_C
Motif
Other DBs
NCBI-ProteinID: ADR19636
UniProt: E4TFY0
Position
complement(1784873..1786327)
Genome map
AA seq 484 aa AA seqDB search
MLVRDLLKGIPVKWVSDDKLYDIDVDNISFNTKDIKPNSAFLLVKGISFDPYEMIDEIFD
SKKVKLFITEKPLPEKPHILVENARRTFGMICRNFFNIDFSKIKSIGITGTNGKTTTNYL
IDSILRVSGYKTIRIGTTEYVIVDEKIEANNTTPGIYDIFEMVAKGVKKGASAVCMEVSS
HALDQDRVYGLNFDVAVFTNLTGDHLDYHKTMEHYYQSKKKLFTKEYSKNAAINIDYDYG
KRLYNEVEIAKYSFSKGKGDVGVVDVSYSLDGINCRVNIGDEVISLNSHLVGRHNLENIL
GAVTATYILGISKDDIIRGVEQFKNVPGRLEKFEKNGAYFFVDYAHTDDALKNVLEALKG
FKKGRLITVFGCGGDRDRTKRPRMAKVAEVYSDIVIVTSDNPRTEDPNAIIDEILTGFEN
RSKVLVDPDRRIAIKKACDEAKAGDIVLIAGKGHEDYQIIGKTKYHFDDREEVAKNLGVT
FEKI
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
atgttggttagggatcttcttaaaggtataccagttaaatgggtatctgatgataagtta
tatgatatcgatgttgacaatatatctttcaatacaaaggatatcaaaccaaactctgct
ttcctacttgtaaaagggatcagctttgatccatatgagatgatagatgagatttttgat
tcgaaaaaggttaaattatttatcacggaaaaaccattacctgaaaaaccacatatattg
gtggaaaatgcaagaagaacatttggcatgatatgtagaaattttttcaatatcgatttc
agtaaaattaaatctattggcatcaccggtacaaatggcaagaccaccacgaactatcta
atcgacagtatattgagggttagtgggtataagaccatcagaatcggtaccacagaatat
gtgatcgttgatgaaaagattgaggcaaataataccacaccagggatttacgatattttt
gaaatggtggcaaaaggggtaaaaaaaggagcttctgcagtttgtatggaagtttcatcg
catgcccttgatcaggatagggtttatgggctgaactttgatgtggctgtattcacaaac
ctcaccggagatcacctggattaccacaaaacaatggaacattactatcagtcaaagaaa
aagttgtttacaaaagaatactctaagaatgctgcaatcaatatcgactacgattatggt
aagagactttataatgaggtggagatagctaaatattctttttctaaggggaaaggtgac
gttggggtagtagacgtttcatattcccttgatggaattaattgcagggtaaatattggt
gatgaagttatttcgttaaattctcatttagtgggaagacataatcttgaaaacatactt
ggtgctgttactgctacatacattttgggtatcagcaaagatgatataatcaggggggtg
gaacagtttaaaaatgttccgggaaggcttgaaaaatttgagaagaatggtgcctatttt
tttgtggactatgcccatactgatgacgccttaaaaaacgttttagaagctttaaagggt
ttcaaaaaggggagacttattacagtttttggttgtggtggagatagagatcgcaccaaa
agaccaaggatggcaaaggttgctgaagtctattcagatattgtgattgtaacaagtgat
aatcccagaactgaagacccaaatgccatcatagatgagatactaacaggttttgaaaat
aggagcaaagttttagtcgatccagataggaggattgccatcaaaaaagcctgtgatgaa
gcaaaagcgggggatatcgttttgatagcaggcaaagggcatgaggattaccagataatt
ggtaaaacaaaatatcattttgacgatagggaagaggttgcgaaaaatctgggggttacc
tttgaaaagatttag

DBGET integrated database retrieval system