KEGG   Calditerrivibrio nitroreducens: Calni_2122Help
Entry
Calni_2122        CDS       T01364                                 

Definition
(GenBank) siroheme synthase
  KO
K02304  precorrin-2 dehydrogenase / sirohydrochlorin ferrochelatase [EC:1.3.1.76 4.99.1.4]
Organism
cni  Calditerrivibrio nitroreducens
Pathway
cni00860  Porphyrin and chlorophyll metabolism
cni01100  Metabolic pathways
cni01110  Biosynthesis of secondary metabolites
cni01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:cni00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Calni_2122
Enzymes [BR:cni01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.76  precorrin-2 dehydrogenase
     Calni_2122
 4. Lyases
  4.99  Other lyases
   4.99.1  Sole sub-subclass for lyases that do not belong in the other subclasses
    4.99.1.4  sirohydrochlorin ferrochelatase
     Calni_2122
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NAD_binding_7 Sirohm_synth_M Shikimate_DH GFO_IDH_MocA TrkA_N
Motif
Other DBs
NCBI-ProteinID: ADR20012
UniProt: E4TKE0
Position
pCALNI01:53888..54343
Genome map
AA seq 151 aa AA seqDB search
MFPLIFKLSDKKLLFIGGGNIAKRKLLSILNQSNPEVTIISKELHPDIKKLLSTNKITWI
KSSFKEELLKQKYDLAFICTDDKELNTKAALILKKIGTPTNICDNKELSDFFTPAIVSQD
DIIISISTKGKSPAFAKQLKEVISKTLKELK
NT seq 456 nt NT seq  +upstreamnt  +downstreamnt
atgttccctttaatctttaaattatctgataagaaattactttttataggcggtggaaat
attgcaaaaagaaaacttttatctattttgaatcaatcaaaccctgaagtgacaataatt
tccaaagaattacatccggatataaaaaagcttttatcaacgaataagataacctggata
aagtcaagctttaaagaggaattattaaaacaaaaatacgatttagcttttatctgcaca
gatgataaagaattaaatacaaaagcagctttaattttaaaaaagataggaactcccaca
aatatatgtgacaacaaagagttatcagatttttttactccagcaattgtttctcaagac
gacattattatttcaatctcaacaaaagggaaatcgccagcttttgcaaaacagttaaaa
gaggtaatatcaaaaaccttaaaagagttaaaatga

DBGET integrated database retrieval system