KEGG   Clostridium novyi: NT01CX_0015
Entry
NT01CX_0015       CDS       T00431                                 

Symbol
pflB
Name
(GenBank) formate acetyltransferase
  KO
K00656  formate C-acetyltransferase [EC:2.3.1.54]
Organism
cno  Clostridium novyi
Pathway
cno00620  Pyruvate metabolism
cno00640  Propanoate metabolism
cno00650  Butanoate metabolism
cno01100  Metabolic pathways
cno01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:cno00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    NT01CX_0015 (pflB)
   00640 Propanoate metabolism
    NT01CX_0015 (pflB)
   00650 Butanoate metabolism
    NT01CX_0015 (pflB)
Enzymes [BR:cno01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.54  formate C-acetyltransferase
     NT01CX_0015 (pflB)
SSDB
Motif
Pfam: PFL-like Gly_radical DUF3029
Other DBs
NCBI-ProteinID: ABK61952
UniProt: A0Q1M2
Position
1668652..1670898
AA seq 748 aa
MTDFWTNFKNGNWTQEIDVQNFIQKNYTLYEGTDDFLANPTEKTKKVWNKAYSLILEELK
KGIMDVETKKFSSIDNFAPGYLDKDNETIVGFQTDAPLKRMMNPYGGMRMVKQSLEQYGF
KMNDGLEETFDEFRKTHNEGVFDAYTEETRTARHVGLLTGLPDAYGRGRIIGDYRRIALY
GIDYLVEQKKKDLKNLKGHATESLIRLREEISEQIKTLGKIKNMAKSYGIDISNPAKNAK
EAMQFIYFGYLAGAKENNGAAMSLGRISTFMDIYIERDLKNGLITEDEAQEIIDQFVIKL
RMIRHLRTPEYNELFAGDPNWITECIGGVSINGKPLVTKTSFRFLHTLTNLGPAPEPNMT
VLWSEKLPEEFKKYCAKMSIETDSIQYENDDLMRPVYGDDYGIACCVSAMQLGKQMQFFG
ARANIAKALLYAINGGIDEIKKESNGELIKVVPNISKINDDILDYNIVKENYFKVLEYVA
DLYVNTMNTIHYMHDKYAYEASQMCLHDSLVHRIMAFGIAGLSCAADSLSAIKYAKVKPI
RNEDGLAVSFEIDGDFPKYGNDDDRVDDIAVAIVKKFSKELKRHKLYRDAEHTLSALTIT
SNVVYGKKTGSTPDGRKLGETLAPGANPMHGRDTNGALASLNSVAKIPYRQWCQDGVSNT
FSIVPKALGNDKNTRILNLVNILDGYFYQGGFHLNVNVLNRETLIDAMENPEKYPTLTIR
VSGYAVHFNRLSKEQQLEVIKRTFHERM
NT seq 2247 nt   +upstreamnt  +downstreamnt
atgacagacttttggacaaattttaaaaacggtaattggactcaggaaatagatgtacaa
aactttattcaaaaaaattatactttatatgaaggtactgatgattttttagctaatcct
acagaaaaaactaaaaaagtttggaacaaagcatattctcttatattagaggaactaaaa
aaagggataatggatgtggaaactaaaaagttctcatctatagataatttcgctcctggt
tatttagataaagataatgaaactatagtaggttttcaaacagatgctcccctaaaaagg
atgatgaatccttatggtggtatgagaatggtaaagcaatctttagaacaatatggtttc
aaaatgaatgatggactagaagaaacctttgatgaatttagaaaaactcataatgaaggt
gtatttgatgcctatactgaagaaactagaactgctagacacgttggtcttttaactgga
cttcctgatgcctatggaagaggaagaattataggagactatagaagaatagctttatat
ggtattgattatctagtagaacaaaagaaaaaagatttaaaaaatttaaaaggacatgct
acagaatctcttattagacttcgtgaggaaatttcagaacaaataaaaacactaggaaaa
attaaaaacatggctaaaagttacggtattgatatatctaacccagctaagaatgccaaa
gaagctatgcaatttatttattttggatacttagccggtgcaaaagaaaacaatggtgct
gcaatgtctcttggtagaatctcaacttttatggatatatacattgaaagagatttaaaa
aatggtttaattacagaagatgaagctcaagaaataatagatcaatttgtaataaaatta
agaatgattcgtcatcttagaacacctgaatacaatgaactatttgccggtgatcctaat
tggataactgaatgtataggtggagtttcaataaacggaaaacctttagttactaaaact
tcttttagatttttacacactttaactaatttaggacctgctccagaacctaacatgaca
gtgctttggtctgaaaaacttcctgaagaatttaaaaagtattgtgctaaaatgtctatt
gaaactgactctattcaatacgaaaatgatgatcttatgcgtcctgtatacggagatgat
tatggaatcgcttgttgtgtatctgcaatgcaattaggtaaacaaatgcaatttttcgga
gcccgcgctaacattgcaaaagcccttttatatgcaattaacggtggaatagatgaaatc
aaaaaagaatcaaatggtgaattaataaaagtagttcctaacatatcaaaaattaatgat
gatattttagactataatattgtaaaagaaaactactttaaggttttagaatatgtagct
gatttatatgtaaacactatgaatactattcactacatgcacgataaatatgcttatgaa
gcaagtcaaatgtgtcttcatgactcacttgttcacagaataatggcatttggtattgct
gggctttcttgtgccgctgattcattaagtgctattaaatacgcaaaagttaaacctatt
agaaatgaagatggactagctgtatcctttgaaatagacggtgatttccctaaatacgga
aatgacgatgatagagttgatgacattgcagttgcaattgtaaagaaattctcaaaagaa
ttaaaaagacataaactatacagagatgctgaacacactctatcagcacttactataact
tctaatgttgtatatggtaagaaaactggatctactcctgatggaagaaagcttggagaa
actttagctcctggtgcaaatcctatgcatggaagagatactaatggtgctcttgcctct
ttaaattctgtagctaaaataccatatagacagtggtgccaagatggagtttcaaatact
ttctctatagtaccaaaagctcttggtaatgataaaaatactagaatcttaaacctggta
aatatactagatggatacttttatcaaggtggcttccatttaaatgtaaatgtattaaac
cgtgaaacattaattgatgctatggaaaatccagaaaaataccctactttaactataaga
gtatctggatatgctgttcactttaatagattatctaaagaacaacaacttgaagtaatt
aaaagaactttccatgaaagaatgtaa

DBGET integrated database retrieval system