KEGG   Clostridium novyi: NT01CX_0145Help
Entry
NT01CX_0145       CDS       T00431                                 

Definition
(GenBank) pyruvate synthase subunit porA
  KO
K00169  pyruvate ferredoxin oxidoreductase alpha subunit [EC:1.2.7.1]
Organism
cno  Clostridium novyi
Pathway
cno00010  Glycolysis / Gluconeogenesis
cno00020  Citrate cycle (TCA cycle)
cno00620  Pyruvate metabolism
cno00633  Nitrotoluene degradation
cno00640  Propanoate metabolism
cno00650  Butanoate metabolism
cno00680  Methane metabolism
cno01100  Metabolic pathways
cno01120  Microbial metabolism in diverse environments
cno01130  Biosynthesis of antibiotics
cno01200  Carbon metabolism
Module
cno_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:cno00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NT01CX_0145
   00020 Citrate cycle (TCA cycle)
    NT01CX_0145
   00620 Pyruvate metabolism
    NT01CX_0145
   00640 Propanoate metabolism
    NT01CX_0145
   00650 Butanoate metabolism
    NT01CX_0145
  Energy metabolism
   00680 Methane metabolism
    NT01CX_0145
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    NT01CX_0145
Enzymes [BR:cno01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     NT01CX_0145
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: POR_N PFOR_II Transketolase_C TPP_enzyme_N DXP_redisom_C
Motif
Other DBs
NCBI-ProteinID: ABK62306
UniProt: A0Q202
Position
complement(1797987..1799174)
Genome map
AA seq 395 aa AA seqDB search
MSKAKQIRKSLSGNEAVATAMMQINPEVVAAFPITPSTEVVQYFSSFIANGKCSTEFVTV
ESEHSAISACIGASAAGARVMTATSSQGLALMWEMLHIAAGDRCPIVMAAVNRALSVPLN
IHNDHSDSMGARDTGFIQLYSENTQEAYDNFIQAVRIAEHEDVLTPAMVCYDGFITSHAV
ENVFLMEKEDVSNFVGENKRFDKGLLGEKKLVGSMVLTNFYMEMKHQQLHGLLNAKKVLL
EVAKEYEELTGRSYGLFEKYRLDDAEVAMVIMGSSAGTAKKVVDDLREKGIKVGVLKIRL
YRPFPAEEIAEALKHVKAVAVMDKAEALSGNGGPVFNDVSSALYGNSEGKILMSYIYGLG
GRDVTVNWLTTVFDDLYAAMKTGEYKKYNYLAVRG
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaaagctaaacaaataagaaaaagtttaagtggtaatgaggcagttgctacagct
atgatgcaaattaatcctgaagtagttgcggcatttccaataactccatctacagaggtg
gttcaatatttttcaagctttatagctaatggaaagtgttcaactgaatttgtaacagta
gaatctgaacatagtgctataagtgcttgtattggtgcttcggcagcaggtgcaagagtt
atgactgctacatcatctcaaggattagcacttatgtgggaaatgcttcatatagcagca
ggtgatagatgtcctatagttatggcagcagttaatagagcattatcagttcctttaaat
attcataatgatcattcggattctatgggagctagggatactggatttatacaattgtat
tctgaaaatacccaagaagcttatgataattttattcaagctgttagaattgcagaacat
gaggatgttttaacaccagctatggtctgctatgatggatttattacaagtcatgctgtt
gaaaacgtattcttaatggaaaaagaagatgttagtaattttgttggtgaaaataagaga
tttgataaaggattgcttggagaaaagaaattagttggttctatggttcttacaaatttc
tatatggaaatgaaacatcaacagcttcatggattattaaatgcaaaaaaagttcttctt
gaagtagctaaagaatatgaagagttaactggaagaagctatggattgtttgagaagtat
agattagatgatgcagaagttgctatggtaattatgggatcttcagcaggtactgctaaa
aaggttgtagacgacttacgagaaaagggaataaaagtaggcgttcttaaaataagatta
tatagaccattcccagcagaagaaattgctgaagctcttaaacatgttaaggcagtagct
gtaatggataaggctgaagcattatcaggaaatggtggtccagtatttaatgatgtttca
agtgcattgtatggaaattcagaaggtaagattttaatgagttatatatatggacttggt
ggaagagatgttacagtaaactggcttacaactgtatttgatgatttatacgcagctatg
aaaactggagaatataaaaaatataattatttagcggtaagaggatag

DBGET integrated database retrieval system