KEGG   Clostridium novyi: NT01CX_0147Help
Entry
NT01CX_0147       CDS       T00431                                 

Gene name
porG
Definition
(GenBank) pyruvate synthase subunit porC
  KO
K00172  pyruvate ferredoxin oxidoreductase gamma subunit [EC:1.2.7.1]
Organism
cno  Clostridium novyi
Pathway
cno00010  Glycolysis / Gluconeogenesis
cno00020  Citrate cycle (TCA cycle)
cno00620  Pyruvate metabolism
cno00633  Nitrotoluene degradation
cno00640  Propanoate metabolism
cno00650  Butanoate metabolism
cno00680  Methane metabolism
cno01100  Metabolic pathways
cno01120  Microbial metabolism in diverse environments
cno01130  Biosynthesis of antibiotics
cno01200  Carbon metabolism
Module
cno_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:cno00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NT01CX_0147 (porG)
   00020 Citrate cycle (TCA cycle)
    NT01CX_0147 (porG)
   00620 Pyruvate metabolism
    NT01CX_0147 (porG)
   00640 Propanoate metabolism
    NT01CX_0147 (porG)
   00650 Butanoate metabolism
    NT01CX_0147 (porG)
  Energy metabolism
   00680 Methane metabolism
    NT01CX_0147 (porG)
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    NT01CX_0147 (porG)
Enzymes [BR:cno01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     NT01CX_0147 (porG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: POR
Motif
Other DBs
NCBI-ProteinID: ABK62151
UniProt: A0Q204
Position
complement(1799480..1800064)
Genome map
AA seq 194 aa AA seqDB search
MDKKLIEIRWHGRGGQGAKTASLLLAEVAFNTGMYIQGFPEYGPERMGAPITAYNRIANF
PLRVHSNIYEPDFVVVVDESLLKSVNCVAGLKKEGAIIINTKKSIDEIRKELCGYEGKVY
TIDARTISEETLGAYFPNTPMLAAIVKVLGIMDLDEFIEDMKDSFKHKFASKPQVISKNM
NALKRSLQEVNGIE
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atggataaaaaactaattgaaattcgttggcatggtcgtggaggtcaaggtgccaaaact
gcttctttacttttagctgaagttgcttttaatactggaatgtatattcaaggatttcca
gagtatggaccagaaagaatgggtgcaccaataactgcatataacagaatagcaaacttt
ccattaagagttcatagtaatatttatgaaccagattttgttgtagtagttgatgaaagc
ttattaaaatcagttaattgcgttgctggattaaaaaaagaaggtgctataataataaac
actaaaaaatccattgatgaaataagaaaagaattatgtggatatgaaggaaaagtgtat
acaatagatgctagaactatttcagaagaaactttaggtgcttattttcctaacacacca
atgcttgctgctatagttaaagtattgggtattatggatttagatgaatttatagaagat
atgaaggattcatttaaacacaaatttgcatcaaaaccccaagtaatatctaaaaacatg
aatgctcttaagagatctcttcaggaggtgaatggaattgagtaa

DBGET integrated database retrieval system