KEGG   Clostridium novyi: NT01CX_0259
Entry
NT01CX_0259       CDS       T00431                                 

Gene name
hemL
Definition
(GenBank) glutamate-1-semialdehyde-2,1-aminomutase
  KO
K01845  glutamate-1-semialdehyde 2,1-aminomutase [EC:5.4.3.8]
Organism
cno  Clostridium novyi
Pathway
cno00860  Porphyrin and chlorophyll metabolism
cno01100  Metabolic pathways
cno01110  Biosynthesis of secondary metabolites
cno01120  Microbial metabolism in diverse environments
cno01240  Biosynthesis of cofactors
Brite
KEGG Orthology (KO) [BR:cno00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    NT01CX_0259 (hemL)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:cno01007]
    NT01CX_0259 (hemL)
Enzymes [BR:cno01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.3  Transferring amino groups
    5.4.3.8  glutamate-1-semialdehyde 2,1-aminomutase
     NT01CX_0259 (hemL)
Amino acid related enzymes [BR:cno01007]
 Aminotransferase (transaminase)
  Class III
   NT01CX_0259 (hemL)
Motif
Pfam: Aminotran_3 Aminotran_1_2
Other DBs
NCBI-ProteinID: ABK62364
UniProt: A0Q2A8
Position
complement(1933384..1934685)
AA seq 433 aa
MKELKHTKSEAMFKEAVKYIPGGVNSPVRAFGSVGLNPIFIDRAKGSKIYDVDGNEYIDY
ICSWGPLILGHSNEKLYEGIEETLRRGTSYGVPTEIEVKMAKLITEAYPSVDMVRMVNSG
TEATMSALRVARGYTRRNKILKFEGCYHGHSDALLVKSGSGTITFGVPTSPGVPEGTVKD
TLVCRYNDIEAVKRIFQEQGNEIAAVIVEPVSGNMGVVPGKQEFLQFLRDITKEYKSVLI
FDEVITGFRLAYGGAQEVYGIEADMTCFGKIIGAGLPVGAYGGKREIMECVSPMGPVYQA
GTLSGNPLAMHMGYKNLNILKENKDVYERLEEKAKRLEEGFNKNIKELGIKATVVRFKAM
LCLFFAEGPLNNYDEVSKCDTEMYAKYFGEMLKRGVLIAPAQFEALFLSDAHTDEDIEYT
IKANYEALKELKC
NT seq 1302 nt   +upstreamnt  +downstreamnt
atgaaagagttaaagcatactaaatcagaagctatgtttaaagaagcagtaaagtatata
ccaggtggagttaatagtccagttagagcatttggttcagttggattaaaccctatattt
atagatagagctaagggttcaaaaatatatgatgttgatggaaatgagtacatagattat
atatgttcttggggaccgcttatactaggacatagtaacgaaaagttatatgaaggaata
gaagaaactttaagacgtggaacaagctacggagttccaacagaaatagaagttaaaatg
gcaaagttaattacagaagcatatccatcagttgacatggtaagaatggttaactcaggt
acagaagctacaatgagtgcattaagagttgctagaggatatacaagaagaaacaaaata
ttaaaatttgaaggatgttatcatggtcattctgatgcattacttgtaaaatcaggttca
ggaactataacttttggtgttccaacaagtcctggagtgccagaaggaacagtaaaagat
actttggtttgtagatataatgacatagaagctgtaaagaggatatttcaagaacaagga
aatgaaatagcagcagttatagttgaaccagtatcaggtaatatgggagttgtgccagga
aaacaagaattcttacagtttttaagagatataactaaggaatataaatctgttcttatt
tttgatgaagttataacaggatttagacttgcctatggtggagctcaagaagtatacgga
atagaagctgatatgacttgctttggaaaaataataggagcagggcttcctgtaggagct
tatggtggaaagagagaaataatggagtgtgtatctccaatgggtccagtatatcaagca
ggaactttatccggaaatcctcttgccatgcatatgggatataagaatttaaatattctt
aaagaaaataaagacgtatatgaaagacttgaagaaaaagctaaaagattagaagaagga
tttaataaaaatataaaagaattaggaataaaggctacagtggttagatttaaagcaatg
ttatgtttattctttgcagaaggaccactaaataattatgatgaagtttcaaaatgtgat
acagaaatgtatgctaagtattttggtgaaatgttaaaaagaggagtgcttatagcacca
gcacaatttgaagcattatttttatcagatgcacatacagatgaagacattgaatacaca
attaaggcaaactatgaggcgcttaaagagttaaaatgttaa

DBGET integrated database retrieval system