KEGG   Clostridium novyi: NT01CX_0259
Entry
NT01CX_0259       CDS       T00431                                 

Gene name
hemL
Definition
(GenBank) glutamate-1-semialdehyde-2,1-aminomutase
  KO
K01845  glutamate-1-semialdehyde 2,1-aminomutase [EC:5.4.3.8]
Organism
cno  Clostridium novyi
Pathway
cno00860  Porphyrin and chlorophyll metabolism
cno01100  Metabolic pathways
cno01110  Biosynthesis of secondary metabolites
cno01120  Microbial metabolism in diverse environments
Module
cno_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:cno00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    NT01CX_0259 (hemL)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:cno01007]
    NT01CX_0259 (hemL)
Enzymes [BR:cno01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.3  Transferring amino groups
    5.4.3.8  glutamate-1-semialdehyde 2,1-aminomutase
     NT01CX_0259 (hemL)
Amino acid related enzymes [BR:cno01007]
 Aminotransferase (transaminase)
  Class III
   NT01CX_0259 (hemL)
SSDB
Motif
Pfam: Aminotran_3 Aminotran_1_2
Other DBs
NCBI-ProteinID: ABK62364
UniProt: A0Q2A8
Position
complement(1933384..1934685)
AA seq 433 aa
MKELKHTKSEAMFKEAVKYIPGGVNSPVRAFGSVGLNPIFIDRAKGSKIYDVDGNEYIDY
ICSWGPLILGHSNEKLYEGIEETLRRGTSYGVPTEIEVKMAKLITEAYPSVDMVRMVNSG
TEATMSALRVARGYTRRNKILKFEGCYHGHSDALLVKSGSGTITFGVPTSPGVPEGTVKD
TLVCRYNDIEAVKRIFQEQGNEIAAVIVEPVSGNMGVVPGKQEFLQFLRDITKEYKSVLI
FDEVITGFRLAYGGAQEVYGIEADMTCFGKIIGAGLPVGAYGGKREIMECVSPMGPVYQA
GTLSGNPLAMHMGYKNLNILKENKDVYERLEEKAKRLEEGFNKNIKELGIKATVVRFKAM
LCLFFAEGPLNNYDEVSKCDTEMYAKYFGEMLKRGVLIAPAQFEALFLSDAHTDEDIEYT
IKANYEALKELKC
NT seq 1302 nt   +upstreamnt  +downstreamnt
atgaaagagttaaagcatactaaatcagaagctatgtttaaagaagcagtaaagtatata
ccaggtggagttaatagtccagttagagcatttggttcagttggattaaaccctatattt
atagatagagctaagggttcaaaaatatatgatgttgatggaaatgagtacatagattat
atatgttcttggggaccgcttatactaggacatagtaacgaaaagttatatgaaggaata
gaagaaactttaagacgtggaacaagctacggagttccaacagaaatagaagttaaaatg
gcaaagttaattacagaagcatatccatcagttgacatggtaagaatggttaactcaggt
acagaagctacaatgagtgcattaagagttgctagaggatatacaagaagaaacaaaata
ttaaaatttgaaggatgttatcatggtcattctgatgcattacttgtaaaatcaggttca
ggaactataacttttggtgttccaacaagtcctggagtgccagaaggaacagtaaaagat
actttggtttgtagatataatgacatagaagctgtaaagaggatatttcaagaacaagga
aatgaaatagcagcagttatagttgaaccagtatcaggtaatatgggagttgtgccagga
aaacaagaattcttacagtttttaagagatataactaaggaatataaatctgttcttatt
tttgatgaagttataacaggatttagacttgcctatggtggagctcaagaagtatacgga
atagaagctgatatgacttgctttggaaaaataataggagcagggcttcctgtaggagct
tatggtggaaagagagaaataatggagtgtgtatctccaatgggtccagtatatcaagca
ggaactttatccggaaatcctcttgccatgcatatgggatataagaatttaaatattctt
aaagaaaataaagacgtatatgaaagacttgaagaaaaagctaaaagattagaagaagga
tttaataaaaatataaaagaattaggaataaaggctacagtggttagatttaaagcaatg
ttatgtttattctttgcagaaggaccactaaataattatgatgaagtttcaaaatgtgat
acagaaatgtatgctaagtattttggtgaaatgttaaaaagaggagtgcttatagcacca
gcacaatttgaagcattatttttatcagatgcacatacagatgaagacattgaatacaca
attaaggcaaactatgaggcgcttaaagagttaaaatgttaa

DBGET integrated database retrieval system