KEGG   Clostridium novyi: NT01CX_0260Help
Entry
NT01CX_0260       CDS       T00431                                 

Gene name
hemB
Definition
(GenBank) delta-aminolevulinic acid dehydratase
  KO
K01698  porphobilinogen synthase [EC:4.2.1.24]
Organism
cno  Clostridium novyi
Pathway
cno00860  Porphyrin and chlorophyll metabolism
cno01100  Metabolic pathways
cno01110  Biosynthesis of secondary metabolites
cno01120  Microbial metabolism in diverse environments
Module
cno_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:cno00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    NT01CX_0260 (hemB)
Enzymes [BR:cno01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     NT01CX_0260 (hemB)
Exosome [BR:cno04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   NT01CX_0260 (hemB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ALAD DUF5066 DUF1433
Motif
Other DBs
NCBI-ProteinID: ABK61054
UniProt: A0Q2A9
Position
complement(1934691..1935662)
Genome map
AA seq 323 aa AA seqDB search
MKILKRPRRLRANTVIRDLVRETTLSTDDFVYPLFIVEGNNIKKEISSLKGQYQLSIDML
EEEIKELVSLGIKSVMLFGIPDVKDEVGCGAYDHNGIVQKATREIKSKFKDMYVITDLCM
CEYTSHGHCGILDEDGYVNNDKTLEYLAKIAVSQAEAGADMIAPSDMMDGRVAVIREALD
KEGFCNIPIMAYSAKYASAFYGPFRDAADSAPSFGDRKSYQMDPANVNEGLREVALDIEE
GADIVMVKPALPYLDVLRKVKDNFNMPIAAYNVSGEYAMVRNAVDAGLLNESAILESLIS
IKRAGADIIITYFAKDAAKMLRG
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgaagattttaaaaagacctagacgtcttagagctaacacagtaataagagatttagtt
agagaaacaactttaagtacagatgattttgtatatcctttatttatagttgaaggaaat
aacataaaaaaagaaatatcatcattaaagggacaatatcaactttctatagacatgtta
gaagaagaaataaaggaacttgtaagtcttggtataaaatctgtaatgttatttggaatt
ccagatgtaaaagatgaagttggttgtggtgcttacgatcacaatggaatagtgcaaaag
gcaactagagaaattaaaagtaaatttaaagatatgtatgtaataactgacctttgcatg
tgcgaatatacatctcatggtcattgtggaatattagatgaagatggatatgtaaataat
gataaaacattagagtatcttgcaaaaatagcagtaagtcaagcagaagcaggggcagat
atgatagcaccttctgatatgatggatggaagagttgcagttataagagaagcacttgat
aaagaaggattttgtaatattccaataatggcctatagtgcaaaatatgcatcagctttt
tacggtccatttagagatgcagcagattcagcgccatcttttggtgatagaaagtcatat
caaatggatccagctaatgtaaatgaaggattgagagaagtagcactagacatagaagaa
ggagcagatattgttatggtaaaacctgcacttccatatttggatgtactaagaaaagta
aaggacaattttaatatgcccatcgccgcttacaacgttagtggagaatatgctatggtt
agaaatgctgtagatgcaggacttttaaatgaaagtgctattttagaatcattaatatct
ataaaaagagcaggagcggatataataattacttattttgcaaaagatgcagcaaaaatg
cttagggggtag

DBGET integrated database retrieval system