KEGG   Clostridium novyi: NT01CX_0263Help
Entry
NT01CX_0263       CDS       T00431                                 

Definition
(GenBank) siroheme synthase, putative
  KO
K02304  precorrin-2 dehydrogenase / sirohydrochlorin ferrochelatase [EC:1.3.1.76 4.99.1.4]
Organism
cno  Clostridium novyi
Pathway
cno00860  Porphyrin and chlorophyll metabolism
cno01100  Metabolic pathways
cno01110  Biosynthesis of secondary metabolites
cno01120  Microbial metabolism in diverse environments
Module
cno_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:cno00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    NT01CX_0263
Enzymes [BR:cno01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.76  precorrin-2 dehydrogenase
     NT01CX_0263
 4. Lyases
  4.99  Other lyases
   4.99.1  Sole sub-subclass for lyases that do not belong in the other subclasses
    4.99.1.4  sirohydrochlorin ferrochelatase
     NT01CX_0263
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NAD_binding_7 Sirohm_synth_M Shikimate_DH TrkA_N AlaDh_PNT_C Pyr_redox Pyr_redox_3 DUF3791 Pyr_redox_2 AdoHcyase_NAD 2-Hacid_dh_C
Motif
Other DBs
NCBI-ProteinID: ABK60735
UniProt: A0Q2B2
Position
complement(1938130..1938726)
Genome map
AA seq 198 aa AA seqDB search
MYYPLMISIDNKKIVVIGGGNVSFRKTKKLLEFGAYVTVISPNILEKFDSLKIKFNDKLK
IIEDYFKSTYIEDAYLVIGATSDKNINKEISNYCRNKNILCNIVDNIKESDFIVPSSIKR
GDLVISVSTMGKSPMLASKIRKELEEKYTDEYEEYIFLLGEARNIILQKFNDEEKRQMLK
SIIDMNIDKLKEFIENNK
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgtattatcctttaatgataagtatagataataaaaagattgttgtaataggtggagga
aatgtatcctttagaaaaactaaaaaactactagagtttggagcatatgttacagttatt
tctcctaatatattagaaaagttcgatagtttaaaaattaaatttaatgataaattaaaa
ataatagaagactattttaaaagtacatatattgaagatgcttatttagtaattggagct
acatcagataagaatataaataaggaaataagtaattattgtaggaataaaaacattctt
tgcaatatagttgataatataaaagagtcggattttatagtgccatcatctataaaacgt
ggtgaccttgtaatttctgtatctaccatgggaaaaagtcctatgttagcttctaaaata
agaaaagagttagaagaaaaatatacagatgaatatgaagaatatatatttcttttagga
gaagctaggaatattatattacaaaaatttaatgatgaagaaaaaagacaaatgttaaaa
tcaataatagatatgaatatagataagcttaaagagtttatagagaataataagtaa

DBGET integrated database retrieval system