KEGG   Clostridium novyi: NT01CX_0603Help
Entry
NT01CX_0603       CDS       T00431                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
cno  Clostridium novyi
Pathway
cno00071  Fatty acid degradation
cno00280  Valine, leucine and isoleucine degradation
cno00310  Lysine degradation
cno00362  Benzoate degradation
cno00380  Tryptophan metabolism
cno00620  Pyruvate metabolism
cno00630  Glyoxylate and dicarboxylate metabolism
cno00640  Propanoate metabolism
cno00650  Butanoate metabolism
cno00900  Terpenoid backbone biosynthesis
cno01100  Metabolic pathways
cno01110  Biosynthesis of secondary metabolites
cno01120  Microbial metabolism in diverse environments
cno01130  Biosynthesis of antibiotics
cno01200  Carbon metabolism
cno01212  Fatty acid metabolism
cno02020  Two-component system
Brite
KEGG Orthology (KO) [BR:cno00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    NT01CX_0603
   00630 Glyoxylate and dicarboxylate metabolism
    NT01CX_0603
   00640 Propanoate metabolism
    NT01CX_0603
   00650 Butanoate metabolism
    NT01CX_0603
  09103 Lipid metabolism
   00071 Fatty acid degradation
    NT01CX_0603
   00072 Synthesis and degradation of ketone bodies
    NT01CX_0603
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    NT01CX_0603
   00310 Lysine degradation
    NT01CX_0603
   00380 Tryptophan metabolism
    NT01CX_0603
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    NT01CX_0603
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    NT01CX_0603
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    NT01CX_0603
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cno04147]
    NT01CX_0603
Enzymes [BR:cno01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     NT01CX_0603
Exosome [BR:cno04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   NT01CX_0603
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III SpoVAD ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: ABK62550
UniProt: A0Q367
Position
complement(2283455..2284636)
Genome map
AA seq 393 aa AA seqDB search
MKNVVIASAVRTAVGKFGGTLKNVPAVELGAIVIKEAIKRAGIKPEMIDETIMGNVIQAG
LGQSPGRQAAVKAGIPVEIPAFTLNKVCGSGLRAVSLAAQMIKAGDADIVVAGGMENMSA
APYVVPGARWGQRMFDGKIVDAMVKDGLWESFNNYHMGMTAENIAAKWNISREDQDQFAL
ASQNKAEKAIKSGRFKDEIVPVVIKTKKGEVVFDTDEHPRFGADIEGLRKLKPAFKKDGG
TVTAGNASGINDGAAALVVMSEEKANELGIKPLAKIVSYGSKGLDPAYMGYGPVGATKVA
LERANLEVKDLDLIEANEAFASQSLAVARDLGFNMDIVNVNGGAIALGHPVGCSGARILV
TLLYEMEKRDAKKGLATLCIGGGMGTAMIVERM
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaatgtagttattgcaagtgcagtaagaacagccgtaggtaaattcggtggaact
ttaaaaaatgtaccagctgttgaattaggcgcaatcgttattaaagaagctattaaaaga
gctggaatcaaaccagaaatgatagatgaaacaataatgggaaatgttattcaagcaggt
ctaggacaaagcccaggaagacaagcagctgtaaaagcaggaattcctgttgaaatacca
gcatttacattaaacaaagtttgtggatcaggattaagagcagtatcattagcagcacaa
atgataaaagcaggagatgctgatatcgtagttgcaggtggtatggaaaacatgtctgct
gcaccatatgttgtaccaggtgctagatggggacaaagaatgttcgatggtaaaatagtt
gatgctatggttaaagatggtctttgggaatcatttaacaattaccatatgggaatgaca
gcagaaaatatagctgcaaaatggaatatatctagagaagatcaagaccaatttgcactt
gcttctcaaaataaagctgaaaaagctataaaatcaggaagatttaaggatgaaatagtt
ccagttgttataaaaactaaaaaaggtgaagttgtatttgatacagatgaacacccaaga
ttcggtgctgacatagaaggattaagaaaattaaagcctgcatttaagaaagatggcggt
acagttacagcaggaaacgcttcaggtatcaatgatggagctgctgcattagttgtaatg
agcgaagaaaaagctaacgaattaggaattaaaccattagctaaaatagtatcttatggt
tcaaaaggattagatcctgcatacatgggatatggaccagttggtgctacaaaagttgca
cttgaaagagctaacttagaagttaaagacttagacttaatagaagctaacgaagcattc
gcatctcaaagtttagcagttgctagagatttaggattcaacatggatatcgtaaatgtt
aacggtggagctattgcacttggtcacccagtaggatgctcaggagctagaatcttagtt
acattattatatgaaatggaaaagagagatgctaaaaaaggtcttgctacactttgcata
ggcggtggaatgggaactgctatgatcgttgaaagaatgtag

DBGET integrated database retrieval system