KEGG   Clostridium novyi: NT01CX_0905Help
Entry
NT01CX_0905       CDS       T00431                                 

Gene name
purA
Definition
(GenBank) adenylosuccinate synthetase
  KO
K01939  adenylosuccinate synthase [EC:6.3.4.4]
Organism
cno  Clostridium novyi
Pathway
cno00230  Purine metabolism
cno00250  Alanine, aspartate and glutamate metabolism
cno01100  Metabolic pathways
Module
cno_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
Brite
KEGG Orthology (KO) [BR:cno00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    NT01CX_0905 (purA)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    NT01CX_0905 (purA)
Enzymes [BR:cno01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.4  adenylosuccinate synthase
     NT01CX_0905 (purA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Adenylsucc_synt
Motif
Other DBs
NCBI-ProteinID: ABK61500
UniProt: A0PXA8
Position
32963..34246
Genome map
AA seq 427 aa AA seqDB search
MSAFVVLGAQWGDEGKGKMTDYLAETADVVVRFQGGNNAGHTVVVGDKEYKLHLVPSGIL
YEDKINVLGNGVVIDPKALFEEINYLEDLGVKVTKEKLKVSDRAQLIMPYHRILDGLKEK
ARGKNDIGTTGKGIGPAYTDKAERSGIRVCDLMHKDVFEEKLRQNINDKNELIRLYGGEE
LDFDKIFEEYNAYADRMRPYVTDISVIIYDEMKKNKNVLFEGAQGSLLDIDYGTYPYVTS
SSTVAGGVCTGAGVGPTAITGAVGIAKAYTTRVGKGPFPTELLDEMGEKLREKGHEYGVT
TGRARRCGWLDLVILKSTARISGLTSFVVTKIDTLAGFDKIKVCTGYEFDGKVIDYFPAS
LEDLAKCKPVYEEFDGWDDSIADARSYEELPENAKIYLKKIEEFTDTKISIVSVGPKRDQ
TIVVGEI
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atgtcagcttttgtagtattaggtgctcaatggggcgatgaaggaaaaggaaaaatgaca
gattatcttgctgaaacagcagacgttgttgttagattccaaggaggaaataacgctggt
catacagttgtagtaggagataaagaatataaacttcacttagttccatcaggaatatta
tatgaagataaaataaatgtattaggaaatggtgttgtaatagatccaaaagctctattt
gaagaaataaactacctagaagatttaggagttaaagttactaaagaaaaattaaaagta
agtgatagagctcaacttataatgccttaccacagaatccttgatggcttaaaagaaaaa
gctagaggaaaaaatgatataggaactacaggaaaaggaataggacctgcatacactgat
aaagctgaaagaagtggaattagagtttgcgatttaatgcataaagatgtctttgaagaa
aagttaagacaaaacataaatgataaaaatgaattaataagactttatggcggagaagaa
ttagacttcgataagatatttgaagaatataatgcttatgcagacagaatgagaccatat
gttacagatatatctgtaataatatatgatgaaatgaagaaaaataagaatgtactattt
gaaggagctcaaggttcattacttgatatagactatggtacttatccatatgttacatct
tcaagcactgtagctggtggagtttgcacaggagcaggtgttggacctacagctataaca
ggagcagtaggtattgcaaaagcttacactacaagagtaggaaaaggacctttcccaaca
gaacttcttgatgaaatgggagaaaagttaagagaaaagggacacgaatacggagtaact
acaggaagagcaagaagatgtggatggcttgaccttgtaatcttaaaaagtacagctaga
atatctggacttacaagctttgttgtaactaaaatagatacacttgcaggattcgacaag
attaaagtttgtactggatatgaatttgacggaaaggtaatagattacttcccagcatct
ttagaagatttagctaaatgcaaaccagtatacgaagaatttgacggatgggacgacagc
atagctgatgctagaagttatgaagaattacctgaaaatgctaagatttacttaaagaaa
atagaagaatttacagatacaaaaatttctatagtatcagtaggtccaaagagagatcaa
actatagtagttggcgaaatttaa

DBGET integrated database retrieval system