KEGG   Clostridium novyi: NT01CX_1813Help
Entry
NT01CX_1813       CDS       T00431                                 

Definition
(GenBank) GTP-binding protein
  KO
K03665  GTPase
Organism
cno  Clostridium novyi
Brite
KEGG Orthology (KO) [BR:cno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:cno03009]
    NT01CX_1813
Ribosome biogenesis [BR:cno03009]
 Prokaryotic Type
  GTPases
   NT01CX_1813
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP-bdg_N GTP-bdg_M MMR_HSR1 MMR_HSR1_Xtn GTP_EFTU RsgA_GTPase Gtr1_RagA Ras FeoB_N Arf ATP_bind_1 G-alpha Roc
Motif
Other DBs
NCBI-ProteinID: ABK61903
UniProt: A0PZT4
Position
1021111..1022895
Genome map
AA seq 594 aa AA seqDB search
MIVGNLEGIRKTILKKLESIYDFKVDRQSIANEQIIQIISEITGDINKEISVAIDRKGNI
LSVAVGDSSTVEMPIIDIKSKKLSGVRIIHTHPNGNSRLSSLDVSALIALKLDCMVAVAV
EDGKCKDVTVGFCGIDNNTLIAEVAPNLPLDKALNINILNVVKNIEINLSSNEVEEDKGE
RAVLVGIENEESLDELCELAKACNVVTVDRVMQRRVKIDTAYFIGEGKVEELSMVRQASN
ANLIIFDDELSASQIRNLESATGTKVIDRTTLILEIFARRAKSKEAKIQVELAQLKYRLP
RLIGMGAVLSRTGAGIGTRGPGEKKLEIDKRHIRERIYDLNKELAKIKKNRQVQREKRSK
DNVPKISLVGYTNAGKSTLRNKLCEIASPKDVVDKETVFEADMLFATLDVTTRALVLPDN
RLVTLTDTVGFIRKLPHDLVEAFKSTLEEVVNSDLLLHVVDSSSKDAYKQIEAVNFVLEE
LESINKPMILLLNKIDKADKEQLEGLKEKFNNLKVLEISAKDNLNLDTLLNDICTALPNP
LKKVEFLIPYSDSASVAMLHRNGKVLEEEYKDNGTRIIAMVDDKIYNKCEKYVI
NT seq 1785 nt NT seq  +upstreamnt  +downstreamnt
atgatagttggaaatttagagggtatacgaaagacgattttaaaaaaactagaaagtata
tacgattttaaggtagataggcaaagtattgcaaatgaacaaattatacaaattataagt
gagataacaggagacataaacaaagaaataagtgtagcaattgatagaaagggaaacatt
ttaagtgtagctgttggtgatagtagcactgttgaaatgcccattatagatataaaatct
aaaaaattatcaggggttagaataatacatacacatcctaatggtaattcaagactttca
tcattagatgtatctgctcttatagcactaaagctagattgtatggtagcagtagcagtt
gaagatggaaagtgcaaggatgtaactgtaggattttgtggtatagataataatacatta
attgcagaagttgcaccaaatcttccacttgataaagcacttaatataaacatattaaat
gtagttaaaaatatagaaataaatctatcatctaatgaagttgaggaagacaaaggggaa
agagcggttttagttggtatagaaaatgaagaaagcttagatgaactttgtgaacttgct
aaagcttgtaatgtagttacagtagatagagtaatgcaaagaagagtaaaaatagatact
gcatattttattggagaaggtaaggttgaagaactttcaatggtaaggcaggcttctaat
gcaaatttaataatttttgatgatgaactatcagcatctcaaattagaaatttagaaagt
gcaacaggaactaaagtaatagatagaacaactttaattcttgagatatttgcaagaaga
gctaaaagtaaagaagctaaaattcaagttgaacttgctcaattaaagtatagacttcca
agattaataggaatgggtgctgtattatctagaacaggtgctggaattggaactagaggt
cctggtgagaaaaaacttgaaatagataaaagacatataagagagagaatatacgatctt
aacaaggaacttgctaagataaagaaaaatagacaggtgcaaagagaaaaaagaagtaaa
gataatgtgcctaaaatatcattggttggatatactaatgctggaaaatctactttaaga
aataaattatgtgaaatagcatcaccaaaagatgtagtagacaaggaaactgtatttgaa
gcagatatgctatttgctactttagatgttacaacaagagcattggtattacctgataat
agattagtaacacttacagataccgttggttttataagaaagctacctcatgatttagta
gaagcatttaaatcaactttagaagaagttgtaaattcagatttactattacatgttgta
gattcatcttcaaaggatgcctataaacaaatagaagctgtaaactttgttttagaagaa
ctagaatctattaataaacctatgatactacttcttaataaaatagataaagcagacaag
gaacaattagaagggctaaaagaaaagtttaataatttaaaagtacttgaaatatcagca
aaggataatttaaatttagacacacttttaaatgatatatgcacggctcttccaaaccct
ctaaaaaaggtagaatttttaataccatatagtgatagtgcctctgttgcaatgcttcat
agaaatggaaaagttctagaggaagaatacaaagataacggtacaagaattattgctatg
gtagatgataaaatatataataaatgcgaaaaatatgtaatataa

DBGET integrated database retrieval system