KEGG   Cloacibacterium normanense: EB819_00620Help
Entry
EB819_00620       CDS       T05730                                 

Definition
(GenBank) hydroxymethylglutaryl-CoA reductase, degradative
  KO
K00054  hydroxymethylglutaryl-CoA reductase [EC:1.1.1.88]
Organism
cnr  Cloacibacterium normanense
Pathway
cnr00900  Terpenoid backbone biosynthesis
cnr01110  Biosynthesis of secondary metabolites
cnr01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:cnr00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    EB819_00620
Enzymes [BR:cnr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.88  hydroxymethylglutaryl-CoA reductase
     EB819_00620
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HMG-CoA_red
Motif
Other DBs
NCBI-ProteinID: AZI68461
UniProt: A0A1E5UGE1
Position
complement(134542..135870)
Genome map
AA seq 442 aa AA seqDB search
MNHKPIEGFSKLSKQHKIDWLINEYLQGNQEYQKILQQYWNDNPDLQKLHEEFSENTITN
FYMPYGIAPNFLIDGKLMALPMAVEESSVVAAASKSAKFWLERGGFKTTIINTEKLGHTH
FIFKVEAHKLLHFFNFTLKKKLFEATEDITANMRKRGGGILDIKLIDKTSELADYYQLKA
SFNTVDSMGANFINSCLEQFGKTLKDEVAQSDAFSEDEKNSIQIVMNILSNFTPDCIVRA
EVSCKIDDLKDDSGISNEEFAWKFKQAVTIAEIEPYRATTHNKGVMNGIDAVVIATGNDF
RATEACAHAYASKDGKYKSLTHCTTDNGIFRFWIDLPISVGVVGGLTNLHPLVKFSLALL
GKPSAQELMSILAVSGLAQNFAALRSLVTTGIQKGHMKMHLFNILNQFGATEEEKQYFVN
YFKDKTVSHHEVISELNKLRNK
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
atgaatcataaaccaattgaaggcttttctaaactttcgaaacaacacaaaattgattgg
ttaataaacgaatatttacaaggaaaccaagaataccaaaagattcttcagcaatattgg
aacgataatccagacttacaaaaactccacgaagaattctcagaaaataccattaccaat
ttttacatgccttacggaattgcgccaaatttcctcattgatggaaaattgatggcttta
ccaatggctgtagaagaaagttctgtagttgctgcagcttccaaatctgcaaaattctgg
ttagaaagaggcggtttcaaaaccacgattattaataccgagaaattaggacacacacac
tttatcttcaaagtagaagcgcataaattattgcattttttcaattttactttaaagaaa
aaactctttgaagctacagaagatattaccgcaaacatgagaaagcgtggtggcggaatt
ttagatattaaactcatagataaaacttcggaattagcagattattatcaattgaaagct
agcttcaacacggtagattctatgggtgctaatttcatcaattcttgtctggaacagttc
ggaaaaacgttaaaagacgaagtagctcaatctgatgctttctcagaagatgagaaaaac
tcaattcagattgtgatgaatattttgtctaacttcactccagattgtatcgtaagagca
gaagtttcttgtaaaattgatgatttaaaagacgacagtggaatttctaacgaagaattc
gcttggaaatttaaacaagcggtaaccattgcagaaattgaaccttacagagcaactacg
cataacaaaggtgttatgaatggtatagatgctgtagtaatagctacaggaaatgatttc
cgtgctactgaagcttgtgcgcatgcttatgcaagcaaagatggcaaatacaaatctctt
acgcattgtactacagacaacggaattttcagattttggatagatttaccaatttctgtt
ggtgtagttggtggtttaacaaatcttcatcctttagtgaaattttctttagcacttcta
ggaaaaccatctgctcaagaattgatgagtattttggcagtttctggtttggctcagaat
tttgctgcacttcgttcattggtgactacaggaatccaaaaagggcatatgaaaatgcac
cttttcaatatcttaaaccaatttggcgctacagaagaagaaaaacaatattttgtcaac
tattttaaagataaaacagtaagtcaccatgaagtgatttcggaattaaataaacttaga
aataaataa

DBGET integrated database retrieval system