KEGG   Cloacibacterium normanense: EB819_04585Help
Entry
EB819_04585       CDS       T05730                                 

Definition
(GenBank) 3-deoxy-8-phosphooctulonate synthase
  KO
K01627  2-dehydro-3-deoxyphosphooctonate aldolase (KDO 8-P synthase) [EC:2.5.1.55]
Organism
cnr  Cloacibacterium normanense
Pathway
cnr00540  Lipopolysaccharide biosynthesis
cnr01100  Metabolic pathways
Module
cnr_M00063  CMP-KDO biosynthesis
Brite
KEGG Orthology (KO) [BR:cnr00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    EB819_04585
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:cnr01005]
    EB819_04585
Enzymes [BR:cnr01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.55  3-deoxy-8-phosphooctulonate synthase
     EB819_04585
Lipopolysaccharide biosynthesis proteins [BR:cnr01005]
 Unusual sugar
  EB819_04585
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAHP_synth_1 NeuB
Motif
Other DBs
NCBI-ProteinID: AZI69196
UniProt: A0A1E5UES3
Position
998326..999138
Genome map
AA seq 270 aa AA seqDB search
MIQLLDKIHHKDSKNFFLIAGPCAIEGEEMAFEIAEKIVNLSDKYKIPYIFKGSFKKANR
SRVDSFTGIGDEKALEIIKKVGEHFNIPTTTDIHENAHAELAASYGVDVLQIPAFLVRQT
DLVVAAAKTGKAVTLKKGQFLSPESMKFAVQKVLDSGNDKVAIIERGNSFGYTDLVVDFR
GIPTMQHYAPVILDVTHSLQQPNQNSGVTGGRPELIETIAKAGIAVGTDGIFIETHPDPS
CAKSDGANMLKLDLLDDLLGKLTRVREAIL
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atgatacaattacttgataaaattcatcacaaagattctaaaaatttctttttaattgct
ggcccttgcgctattgaaggcgaagaaatggcatttgaaattgccgaaaaaattgttaat
ctttcagataaatataaaattccttacatttttaaaggaagttttaaaaaagccaacaga
agcagagtagacagtttcacaggaattggtgacgaaaaagctttagaaattatcaaaaaa
gtaggagagcattttaatattcctactactacagatattcacgaaaacgctcatgcagaa
ctcgcagcttcttatggagtagatgttttgcaaattcccgcgtttttggttcgtcagaca
gacttggtagtagctgcagcaaaaactgggaaagccgtaactttgaaaaaaggacaattt
ctttcaccagaatctatgaaatttgcggtacaaaaagtattagattcaggaaatgataaa
gtagcgattatcgagagaggaaattctttcggatatacagatttggtagtagatttcaga
ggaattcctaccatgcaacattatgcgccagtgattttggacgttacgcactctcttcaa
cagcctaatcaaaattcaggagtaacaggaggaagaccagaattgatagaaaccattgcc
aaagctggaattgcagtaggaacagacggaattttcattgaaacacatccagatccttct
tgtgcaaaatcagacggagcgaatatgctaaaactggatttgctcgatgatttattagga
aaactaactcgagtaagagaagcaatcttataa

DBGET integrated database retrieval system