KEGG   Cedecea neteri SSMD04: JT31_00760Help
Entry
JT31_00760        CDS       T03298                                 

Definition
(GenBank) ornithine cyclodeaminase
  KO
K21721  N-[(2S)-2-amino-2-carboxyethyl]-L-glutamate dehydrogenase [EC:1.5.1.51]
Organism
cnt  Cedecea neteri SSMD04
Pathway
cnt00998  Biosynthesis of secondary metabolites - other antibiotics
cnt01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cnt00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00998 Biosynthesis of secondary metabolites - other antibiotics
    JT31_00760
   00999 Biosynthesis of secondary metabolites - unclassified
    JT31_00760
Enzymes [BR:cnt01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.51  N-[(2S)-2-amino-2-carboxyethyl]-L-glutamate dehydrogenase
     JT31_00760
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OCD_Mu_crystall Shikimate_DH Glu_dehyd_C Sacchrp_dh_NADP
Motif
Other DBs
NCBI-ProteinID: AIR03206
UniProt: A0A089PWA3
Position
complement(174400..175395)
Genome map
AA seq 331 aa AA seqDB search
MQIVNRQQVAELGGNDPIKALQDVEDTVRLLRNGEAVMPAETHVDLDTPLGKVYALPARV
GGRFNATGVKWTAHRPRAADGYPQAMATTLLNRADNGLPVGLVESGSLTATRTAAVSALA
LKLAAPLRPSRVLLLGAGVQARAHLDMLAAHFPDLEMVYCWNKTPEPLADMLSHSGDLPW
PVTQFETLSDALRQHWDVLITCTSASEPFLRPGIWRAGTLVLQIGYHEVAFETIAAADKV
VVDLWGDFKLTSAKSLFQMYRAGLFDEQNVAADLTNLLVDGWRPSATDRVYFSSFGLNVF
DIALAARVLQAAVDQGQGSNLPFGWEAADAD
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atgcagatagtgaaccgtcagcaggtcgctgaactcggcggcaacgacccgatcaaggcg
ttgcaggacgttgaggacaccgtgcggctgctaagaaacggcgaggcggtgatgccggcg
gaaacccatgtcgatctggacacgccgctgggcaaagtttacgccctcccggcaagggtt
ggcggacggttcaacgccacaggcgtgaaatggacggcccatcgccctcgcgccgctgac
ggctatccgcaggctatggcaacgacgttgctcaaccgggcggataacggcttaccggtt
ggcctggtggaaagtggcagcctgacagcaacccgcacggcggcggtgtctgccctcgcc
ctcaagctggcggcacctctgcgaccttcacgcgtcttattgcttggcgcaggcgttcag
gcccgcgcccatctcgatatgttggccgcacattttcccgatctggaaatggtctactgc
tggaataaaacgccggagccgctcgccgacatgctcagccattctggcgacctgccctgg
cccgttacgcagtttgaaacactgagcgatgcgttgcgtcagcactgggacgtactgata
acctgcaccagcgccagcgagccgtttttacgccctggcatctggcgtgcggggacgctg
gtgctgcaaattggctaccacgaagtggcttttgaaacgatcgccgccgccgacaaagtg
gtggtagatctttggggcgacttcaagctaaccagcgccaaaagcctgttccagatgtac
cgtgccgggctttttgacgagcaaaacgtggcggcagatttaaccaatttgctggtggat
ggctggcgtccttcggcaaccgacagagtttatttttcctctttcggccttaacgtgttt
gatatcgcccttgccgctcgcgtgctgcaggctgccgtagaccagggccagggcagcaat
ctaccttttggctgggaagctgccgatgctgattag

DBGET integrated database retrieval system