KEGG   Cedecea neteri SSMD04: JT31_05355Help
Entry
JT31_05355        CDS       T03298                                 

Definition
(GenBank) threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
cnt  Cedecea neteri SSMD04
Pathway
cnt00260  Glycine, serine and threonine metabolism
cnt01100  Metabolic pathways
cnt01110  Biosynthesis of secondary metabolites
cnt01120  Microbial metabolism in diverse environments
cnt01130  Biosynthesis of antibiotics
cnt01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:cnt00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    JT31_05355
Enzymes [BR:cnt01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     JT31_05355
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_1_2 Aminotran_5 Cys_Met_Meta_PP DegT_DnrJ_EryC1
Motif
Other DBs
NCBI-ProteinID: AIR04058
UniProt: A0A089PVK1
Position
1164457..1165458
Genome map
AA seq 333 aa AA seqDB search
MIDLRSDTVTRPSRAMLEQMMAAPTGDDVYGDDPTVNELQEYAAKISGKEAALFLPTGTQ
ANLVALLSHCERGEEYIVGQAAHNYLYEAGGAAVLGSIQPQPIEADRDGSLPLDKVAAKI
KPDDIHFARTKLLSLENTHNGKVLPREYLQQAWEFTRKHNLALHVDGARIFNAVVSYGCQ
LEDITRYCDSFTICLSKGLGTPVGSLLVGSKEYIKRAIRWRKMTGGGMRQAGILAAAGLY
ALKNNVERLKEDHDNAHWLAGELREIGVDVMRQDTNMVFVRMTAEEAEDLGPYMRERGII
ISAGPATRLVTHLDVTRSQLAEVVAHWRSFLQN
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atgatcgatttacgcagcgataccgttacccgcccttcccgcgccatgcttgagcaaatg
atggccgcgccgaccggagatgacgtttacggcgacgacccgaccgttaacgagcttcag
gagtacgcggcaaaaatcagcggtaaagaagctgccctgtttttacctaccggcactcag
gctaacctggtggcgttgctcagccactgcgagcgtggcgaagagtacatcgttggccag
gccgcacataactacctctatgaagccggtggtgcagcggtactgggcagcattcagcct
cagcctatcgaagcggatcgcgacggctccctgccgctggacaaagtggcggccaaaatt
aagccggacgacattcacttcgcccgcactaaattattgagccttgagaatacccataac
ggcaaagtgctgccgcgcgaatatctccagcaggcctgggagttcacccgcaagcacaac
ctggcgctgcacgttgacggcgcgcgtatcttcaacgccgtggtttcctatggctgccag
ctggaagacattacccgctactgcgacagcttcaccatctgcctgtcgaaaggcctgggc
acgccggttggctccctgctggtgggcagtaaagagtacatcaaacgtgccatacgctgg
cgcaagatgaccggtggcggcatgcgccaggccgggattctggcggcggctggcctgtat
gcgctgaaaaataacgttgagcgcctgaaagaagatcacgataacgctcactggctggct
ggcgagctgcgtgaaattggcgttgacgtaatgcgccaggataccaacatggtgttcgtg
cgcatgacggcggaagaagcggaagatttaggcccctacatgcgtgagcgcggcatcatc
atcagcgcgggcccggcaacgcgcctggtcacccatctggacgtcacccgcagtcagctg
gctgaagtcgtcgcccactggcgcagcttcctgcaaaactaa

DBGET integrated database retrieval system