KEGG   Cedecea neteri SSMD04: JT31_07950Help
Entry
JT31_07950        CDS       T03298                                 

Definition
(GenBank) AMP-dependent synthetase
  KO
K03367  D-alanine--poly(phosphoribitol) ligase subunit 1 [EC:6.1.1.13]
Organism
cnt  Cedecea neteri SSMD04
Pathway
cnt00473  D-Alanine metabolism
cnt01100  Metabolic pathways
cnt01503  Cationic antimicrobial peptide (CAMP) resistance
cnt02020  Two-component system
Brite
KEGG Orthology (KO) [BR:cnt00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    JT31_07950
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    JT31_07950
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01503 Cationic antimicrobial peptide (CAMP) resistance
    JT31_07950
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   01504 Antimicrobial resistance genes [BR:cnt01504]
    JT31_07950
Enzymes [BR:cnt01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.13  D-alanine---poly(phosphoribitol) ligase
     JT31_07950
Antimicrobial resistance genes [BR:cnt01504]
 Gene sets
  CAMP resistance modules
   Cationic antimicrobial peptide (CAMP) resistance, dltABCD operon [MD:M00725]
    JT31_07950
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: AIR04546
UniProt: A0A089PZZ1
Position
1690956..1692389
Genome map
AA seq 477 aa AA seqDB search
MNLHPELHELQDFLRAALLDPARPHQLAISGSDSALTWQQLSTAAADWAQRYAQHQQPAG
TPVVLYGHQQAEFAVAIYSCLLHNIPYIPVDCIYPQERLKEICQLASAPYYYDVVTKQFV
ATGEAGSVLAEPDLAYIMFTSGSTGKPKGVQIGRESLWHFMQWVRQDFALPDVPVLMNHA
VFSFDLSLIPLLANLATGGHIVLNAKEDIAAENWLERLKTNGVSAWVSTPSFAYQKLLSP
QFNGDYLPELSVFVFIGEVLNKALVKQLRRRFPQAKILNSYGPTEATIATTVIEITDEIL
HSENDVLPVGTMMPESRMEITPEGELIIWGKNVMRGYLGLPQENAAKLLHRETEQYRGYR
TGDLGYEDGLLYCQGRNDNQIKLNGYRIEINEIENRLLAMSGISEAVVLPLMKSGGGVLR
IAAFCVTGLAPEAIKTSLSKVIPPYMVPSQIIIKDALPLNPNGKIDRKLLDTQARTN
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atgaaccttcaccccgagcttcatgaactgcaggattttctgcgagcggcattactcgat
cccgctcgcccacaccagttagccatcagcggcagcgatagcgccctgacctggcagcag
ctttctaccgccgcagccgactgggcacagcgttacgcgcagcaccagcagccggcgggc
acgccggtagttttgtacgggcatcagcaggccgagtttgcggtggctatctatagctgc
ctgctgcacaacatcccgtacattccggtggactgcatctacccgcaggagcggctgaaa
gagatctgccagcttgccagcgctccttactattacgatgtggtcacgaagcagtttgtg
gcgaccggagaagcgggcagcgtgctggccgaaccagatttggcctacatcatgtttact
tcaggcagcaccgggaaaccgaagggcgtgcagattggccgcgagagcctgtggcacttt
atgcagtgggtgcgccaggacttcgcgctgccggacgtgccggtgctgatgaaccacgcg
gtattcagcttcgacctttcccttatcccgttgctggcaaacctcgccaccggcgggcac
atcgtgctgaatgcgaaagaggacatcgccgctgagaactggcttgaacgcctgaaaacc
aacggcgtatcggcctgggtttccacgccctcttttgcctaccagaaactgctttccccg
cagtttaacggcgactatttacccgagctgagcgtgtttgtattcatcggcgaagtatta
aataaggcgctggtaaaacagctgcgccgccgcttcccgcaggccaaaatcctgaattcc
tatggcccgacggaggcgaccatcgccaccacggtgattgaaattaccgacgagatcctg
cacagcgaaaacgacgtgctgccggtgggcaccatgatgccggagtcgaggatggaaatt
accccggaaggtgagctgatcatctgggggaaaaacgtcatgcgcggttacctcgggctg
ccgcaggaaaacgcggcgaaattgctgcaccgcgaaactgagcaataccggggctaccgg
accggcgatctcggctacgaagacgggctgctttactgccagggccgcaacgacaaccag
atcaagctgaacggctaccgcattgagattaacgagattgaaaaccgcctgctggcgatg
tccggcattagcgaggccgtggtgctgccgctgatgaagtccggcggcggcgtgctgcgt
attgcggcgttttgcgtcaccggcctggcgccggaagccatcaaaacgtcgctgtcgaag
gtgatcccgccttatatggtgccttcgcaaatcattattaaagacgctttgccgctgaac
cctaacggcaaaatcgaccgcaagctgctggacacccaggctcgcacgaattaa

DBGET integrated database retrieval system