KEGG   Cedecea neteri SSMD04: JT31_12315Help
Entry
JT31_12315        CDS       T03298                                 

Definition
(GenBank) alpha-D-glucose-1-phosphatase
  KO
K20866  glucose-1-phosphatase [EC:3.1.3.10]
Organism
cnt  Cedecea neteri SSMD04
Pathway
cnt00010  Glycolysis / Gluconeogenesis
cnt01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:cnt00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    JT31_12315
Enzymes [BR:cnt01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.10  glucose-1-phosphatase
     JT31_12315
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HAD_2 Hydrolase Hydrolase_like HAD PerC Acid_PPase
Motif
Other DBs
NCBI-ProteinID: AIR05362
UniProt: A0A089PYC7
Position
complement(2606181..2606777)
Genome map
AA seq 198 aa AA seqDB search
MLYIFDLGNVIVDIDFNRVLGVWSDYSRVPLANLQKSFAMGETFHQHERGQITDEVFAER
LCHEMDVALSYEQFAAGWQAIFVGLRKETIGVMQKLREQGHRVVVLSNTNRLHTGFWPDE
YPEVAQSADKIYLSQEMGMRKPDAEIYLKVLQEEGFSADQAVFFDDNADNIIGARALGIN
SIQVLDKKTIPDWFAKQG
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgctgtatatctttgatttaggtaacgtcatcgttgatatcgactttaatcgcgtactg
ggcgtctggagtgattacagccgggtgccgttagccaacctgcagaaaagtttcgcgatg
ggagaaaccttccatcagcacgaacgtgggcaaataacggatgaagtgtttgccgaacgc
ctgtgccatgaaatggacgttgcgctgagctacgagcagtttgccgcgggctggcaggcc
attttcgttggcctgcgcaaagagacgattggcgtcatgcaaaaactccgcgagcaggga
catcgcgtcgtggtcctttccaataccaaccgcctgcacaccggattctggcctgatgaa
tacccggaagtggcgcaatcggccgataaaatctatctctcccaggaaatggggatgcgc
aagccggacgcggaaatctacctcaaagtgctgcaggaagaaggattctctgcggatcag
gccgtgttcttcgatgacaacgccgacaatattatcggcgcgcgggcattaggtattaac
agtattcaggtgctcgacaagaagaccatcccagactggtttgctaagcagggatga

DBGET integrated database retrieval system