KEGG   Cedecea neteri SSMD04: JT31_13310Help
Entry
JT31_13310        CDS       T03298                                 

Definition
(GenBank) mannitol-1-phosphate 5-dehydrogenase
  KO
K00009  mannitol-1-phosphate 5-dehydrogenase [EC:1.1.1.17]
Organism
cnt  Cedecea neteri SSMD04
Pathway
cnt00051  Fructose and mannose metabolism
cnt01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cnt00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    JT31_13310
Enzymes [BR:cnt01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.17  mannitol-1-phosphate 5-dehydrogenase
     JT31_13310
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mannitol_dh_C Mannitol_dh 3HCDH_N ApbA
Motif
Other DBs
NCBI-ProteinID: AIR05555
UniProt: A0A089RGD6
Position
2833648..2834796
Genome map
AA seq 382 aa AA seqDB search
MKALHFGAGNIGRGFIGKLLADAGLQLTFADVNQVVLDALNARHSYQVHVVGEQQQIDTV
SNVNAVSSIGDDVVALIAQVDLITTAVGPVVLERIAPTLAKGLELRRANANDAPLNIIAC
ENMVRGTSQLKEHVKKALSAEAWAWVEQHVGFVDSAVDRIVPPSESATNDPLEVTVETFS
EWIVDKTQFKGELPNIPGMELTDNLMAFVERKLFTLNTGHAITAYLGQLAGHQTIRDAIL
DEKVRAVVKGAMEESGAVLIKRYGFEADKHAAYIKKILGRFENPYLKDDVERVGRQPLRK
LSAGDRLVKPLLGTIEYGLPHVNLIKGIAAAMHYHSEQDPQAQELKQLLADKGPQAALVE
VSGLDANSEAVTEAVKAYNAIA
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcattacattttggtgcaggtaatatcggtcgtggctttatcggtaaactgctg
gcagacgccggtctgcagctgacttttgccgacgtaaaccaggtggttctggatgcgctg
aacgcgcgtcacagctaccaggttcacgtagtgggcgagcagcagcagattgataccgtc
tccaacgtgaatgccgtcagcagcatcggcgacgacgtggtcgcgcttatcgcgcaggta
gacctgattaccaccgctgtgggccctgtcgtgctggagcgcattgctccaacgcttgct
aaaggcctggagctgcgtcgcgccaacgccaacgacgcgccgctgaacattatcgcctgt
gaaaacatggtgcgcggcaccagccagctgaaagagcacgtgaaaaaagcgctgtccgct
gaggcgtgggcgtgggttgagcagcacgttggctttgtcgattctgcggttgaccgcatc
gttccaccgtccgagtccgccaccaacgacccgctggaagtgaccgtggaaacctttagc
gagtggattgttgataaaacccagttcaaaggtgagctaccgaacattcctggcatggaa
cttactgataatcttatggcgtttgtcgagcgcaagctcttcacgctgaataccgggcat
gctataaccgcgtacctcggtcagctggccgggcaccagactatccgcgatgcgattctt
gatgagaaagtgcgcgccgtagtgaaaggggcgatggaagagagcggcgcggtgctgatt
aagcgctacggctttgaagccgacaagcacgccgcgtacatcaagaaaatccttggtcgt
ttcgaaaacccttacctgaaggacgacgtggagcgcgttggccgtcagccgctgcgcaaa
ctcagcgccggcgatcgcctcgtcaagccgctgctcggcaccattgagtacggcttaccg
cacgtgaacctgatcaaagggattgcagcggcaatgcactaccacagcgagcaggacccg
caggctcaggagctgaagcagctgctggctgataagggcccgcaggccgcgctggtggaa
gtgtcgggtctggatgcaaatagcgaagccgtgaccgaggcggtgaaggcgtataacgcc
atagcgtaa

DBGET integrated database retrieval system