KEGG   Cedecea neteri SSMD04: JT31_16520Help
Entry
JT31_16520        CDS       T03298                                 

Definition
(GenBank) tRNA pseudouridine synthase C
  KO
K06175  tRNA pseudouridine65 synthase [EC:5.4.99.26]
Organism
cnt  Cedecea neteri SSMD04
Brite
KEGG Orthology (KO) [BR:cnt00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:cnt03016]
    JT31_16520
Enzymes [BR:cnt01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.26  tRNA pseudouridine65 synthase
     JT31_16520
Transfer RNA biogenesis [BR:cnt03016]
 Prokaryotic type
  tRNA modification factors
   Psudouridine synthases
    JT31_16520
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2
Motif
Other DBs
NCBI-ProteinID: AIR06158
UniProt: A0A089Q1J3
Position
3497416..3498195
Genome map
AA seq 259 aa AA seqDB search
MLEIIYQDEWLVAVNKPSGWLVHRSWLDRHEKVVVMQTVRDQIGQHVFTVHRLDRPTSGV
LLMGLSSEVGRLLSQQFEQHQMQKGYHAVVRGWLEDEAVLDYPLVEELDKIADKFSDQDK
APQPAVTHYRGLATVEMPVAVGRYPTARYSLVELEPKTGRKHQLRRHLSHLRHPIIGDSK
HGDLRQNRGAAEHFGCERLMLHASQLSLNHPVTGEPLTIRAGLDDTWMQMLTKFGWRGQL
PDVENIEFDPASRQDKPCP
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atgctggagattatttaccaggatgagtggctggttgcggtaaacaaaccgtccggctgg
ctggtgcaccgtagctggctggacaggcacgaaaaagtcgtggtgatgcaaaccgttcgc
gaccagattggccagcatgtttttaccgtgcaccgccttgaccggccaacctccggcgta
ctgctgatggggttatccagcgaggttggacgcctgctgtcgcagcagtttgagcagcac
cagatgcagaagggttaccatgccgtggtacgtggctggctcgaggatgaagcggtgctg
gattatccgctggtggaagagctggataaaatcgccgataagtttagcgaccaggataaa
gccccgcagcctgcggtgacgcattatcgtggcttagcgacggtcgagatgccggtggcc
gtagggcgttatcctaccgctcgctacagcctggtggagcttgagccaaagaccggccgt
aaacaccagcttcgtcggcatttgtcgcatcttcgccatcccattattggtgattccaaa
cacggtgatttgcgccagaaccgaggcgcggcggaacattttggctgcgagcgtctgatg
ctgcacgccagtcagctctcgttaaaccatccggttaccggagagccgctgacgatccgg
gcggggctggatgacacctggatgcaaatgctgacaaaatttggctggcgcggccagctg
ccggatgttgaaaatattgagtttgatccggcgagccgccaggataagccttgtccctaa

DBGET integrated database retrieval system