KEGG   Cedecea neteri SSMD04: JT31_19660Help
Entry
JT31_19660        CDS       T03298                                 

Definition
(GenBank) phosphotransfer intermediate protein in two-component regulatory system with RcsBC
  KO
K07676  two-component system, NarL family, sensor histidine kinase RcsD [EC:2.7.13.3]
Organism
cnt  Cedecea neteri SSMD04
Pathway
cnt02020  Two-component system
Brite
KEGG Orthology (KO) [BR:cnt00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    JT31_19660
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cnt01001]
    JT31_19660
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:cnt02022]
    JT31_19660
Enzymes [BR:cnt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     JT31_19660
Protein kinases [BR:cnt01001]
 Histidine kinases
  NarL family
   JT31_19660
Two-component system [BR:cnt02022]
 NarL family
  RcsC-RcsD-RcsB (capsule synthesis)
   JT31_19660
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RcsD_ABL HATPase_c Hpt DUF1771
Motif
Other DBs
NCBI-ProteinID: AIR06751
UniProt: A0A089Q643
Position
complement(4167732..4170392)
Genome map
AA seq 886 aa AA seqDB search
MSQSENTSLNKFSLFPGNITRFFLLLTIVLLVSMGVLVQSAVNAWLKDKSYQIVDITHAL
HKRVETYRYATWQIYDNIATAPAASGENLQETRLRQDVYYLDKPRSKTEALIFGSHDSST
LEMTQRISGYLDTLWGAENSPWSMYYLNGQDNSMILVSTLPLKDLSSGFKDSGVGTIVDS
RRAEMLQQANALDERESFSSLRKLNWQNGHYFTLRTTFNQPGHLATVVAFDLPINDLIPP
TMSLDSFQLEPDERQRAAATATDKDDPDSVSINFNSARIEITAPVATTQLQLVWKVPFGT
LMMDTLQNILLPLLLNIALLGLAVFGFATFRQQPQRQTESNPGNGELQILRALNEEIVAI
LPLGLLVHDLDANRTVISNKIADHLLPHLNLQNIISMADQHQGVIQATVNNELYEIRQFR
SQIAPRTQIFVIRDQDREILVNKKLKQAQRLYEKNQQGRAAFMQHIGEALQLPVKQLAEH
AAEINDDKHLQLSNDAQTIVRLVDEIQLLNMLEADSWKTQASEFSIQSLVDEVALSMLPI
IKRKGLQLLINNNLPADEKRHGDKDVLRKILELLLHYSVTTTQIGKITLEISEEEAGPDR
LLFRVLDTGNGIGNGEVDNLHFPFLNETSEDRYGQANGLAFYLCDRLARKLGGHLNIKTR
PDIGTRYNLHIRMAAEPQAEMQEEKLLDDVVAMLDITSNEVRTIVTRMLENWGANCISPD
ERLASQDFDIFLTDNPSNLTASGLLLSDDENGMRKIAPGQFRVNFNISNAMQDAVLQLIE
NQLAEEDTPDSPLGGDENAQLHASGYYALFVDTVPEDVTRLYTESAAGDFAALAQTAHRL
KGVFAMLNLVPGKQLCETLEHHIRESDAPDIQKYISDIDAYVKSLL
NT seq 2661 nt NT seq  +upstreamnt  +downstreamnt
atgagccagtctgaaaatacgtcgctaaataagttctcactgttccccggcaacattacg
cgcttctttttgctgctgaccatcgtactgctcgtctccatgggcgtgctggtgcaaagc
gccgttaatgcctggctgaaggacaaaagctatcagattgtcgacatcacgcatgccctg
cataagcgggtagaaacctatcgctatgcgacgtggcaaatctacgacaatattgccacc
gcgcctgcggcctctggggaaaacctgcaggaaacccgcctgcgccaggacgtgtattac
ctcgacaagccacgcagcaaaaccgaagcgctgatctttggctcccatgacagctctacg
ctggaaatgacgcagcggatatccggctacctggacacgctttggggcgcggagaacagc
ccctggtcgatgtactacctgaacggccaggacaacagcatgatcctggtctctaccctg
ccgctaaaagatctctcctccggctttaaagactctggcgttggtaccatcgtggactca
cgccgggcagagatgctgcagcaggccaatgccctggacgagcgcgaaagtttctcttcg
ctgcgcaagctaaactggcaaaacggccattacttcacgcttcgaaccacctttaatcag
cctgggcatctggccaccgtggtcgcatttgatttgcctattaacgatcttattccaccg
acaatgtcgctggacagcttccagctcgagccagatgagcgccagcgggccgccgctacg
gcaacggataaagacgatccggacagcgtgagcattaattttaatagcgcccggattgaa
atcaccgcaccggtggccacaactcagctccaactggtgtggaaggtaccgtttggtacg
ctgatgatggatacgctgcaaaacattcttctgccgttgctgctgaacattgcgctgctc
gggttagccgtttttggcttcgcgaccttccgccagcagccccagcgccagaccgaaagc
aatccgggtaacggtgagctacaaatcctgcgggcgctaaacgaagagatcgtggccatc
ctgccgcttggcctgctggtccacgacctcgatgccaatcgcacggtaataagcaacaaa
attgccgaccacctgctgccccatctgaacttgcaaaacatcatttcgatggcggatcag
caccagggcgttattcaggccacggtaaataatgagctgtatgagattcgtcagtttcgc
agccagatagcgccgcgcacgcagatttttgttatccgcgatcaggatcgtgaaattctg
gtaaacaagaagctcaagcaggcccagcgcctgtatgagaaaaaccagcagggccgcgcc
gcctttatgcagcacattggcgaggcgctacagctgccggttaagcagctggccgaacat
gcggcagaaattaacgacgataaacacctgcagctctcgaacgatgcacagactattgtg
cgcctggtcgatgaaattcagttgttgaatatgctggaagcagacagctggaaaacccag
gccagcgagttttccatccagtcgcttgtcgatgaagtggcgctgtcgatgctgccgatt
atcaagcgtaaagggctacagctgctcatcaacaacaacctgccggccgatgaaaaacgc
cacggcgacaaagacgtgctgcgaaaaattctggaactcctgctgcattactcggtgacg
accacgcagattggcaaaattacgcttgaaatcagcgaagaggaagccgggccggatcgc
ctgctgttccgtgtgcttgataccggcaacgggatcggcaacggagaagtggataatctg
catttcccgttccttaacgagacaagtgaagaccgctacggccaggccaatggtctcgcg
ttttatctctgcgatcgccttgcgcgcaagctcggtggccacctgaacatcaaaacgcgc
ccggacatcggcacgcgctataatttacacatcagaatggccgctgagccccaggcggag
atgcaggaagaaaaactgctggatgatgtcgtggcaatgctggatatcacctccaatgag
gtgcgtaccattgtgaccagaatgctggaaaactggggcgcaaactgtatttccccggac
gaaagactggcgagtcaagactttgatatcttcctcactgataatccgtctaatcttact
gcttcgggcttgcttttaagcgatgatgaaaacgggatgcggaaaatcgccccaggccag
ttccgggtcaactttaatatcagcaatgcgatgcaggatgccgttctgcagctgattgaa
aaccaactggcggaggaagatacgccggactcgcctctgggcggcgatgaaaacgctcag
ctgcacgccagcggttattacgcgctgtttgtcgacacggtaccggaagatgttaccagg
ctgtatactgaatctgcagcgggcgactttgccgctctggctcagacagcgcaccgcctg
aagggcgtgtttgcgatgctgaatctcgtgcccggcaaacagttatgtgaaacgttggag
caccacattcgtgaaagtgacgctccagacatacaaaaatatatcagcgacattgatgct
tatgtcaaaagtctgctgtag

DBGET integrated database retrieval system