KEGG   Corynebacterium sp. ATCC 6931: DR71_1211Help
Entry
DR71_1211         CDS       T03283                                 

Gene name
gluQ
Definition
(GenBank) glutamyl-queuosine tRNA(Asp) synthetase
  KO
K01885  glutamyl-tRNA synthetase [EC:6.1.1.17]
Organism
coa  Corynebacterium sp. ATCC 6931
Pathway
coa00860  Porphyrin and chlorophyll metabolism
coa00970  Aminoacyl-tRNA biosynthesis
coa01100  Metabolic pathways
coa01110  Biosynthesis of secondary metabolites
coa01120  Microbial metabolism in diverse environments
Module
coa_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:coa00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    DR71_1211 (gluQ)
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    DR71_1211 (gluQ)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:coa01007]
    DR71_1211 (gluQ)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:coa03016]
    DR71_1211 (gluQ)
  09183 Protein families: signaling and cellular processes
   02048 Prokaryotic defense system [BR:coa02048]
    DR71_1211 (gluQ)
Enzymes [BR:coa01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.17  glutamate---tRNA ligase
     DR71_1211 (gluQ)
Amino acid related enzymes [BR:coa01007]
 Aminoacyl-tRNA synthetase
  Class I (A)
   DR71_1211 (gluQ)
Transfer RNA biogenesis [BR:coa03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    DR71_1211 (gluQ)
 Prokaryotic Type
   Other AARSs
    DR71_1211 (gluQ)
Prokaryotic defense system [BR:coa02048]
 Toxin-antitoxin system (TA system)
  Type II TA system
   Type II TA system related factors
    DR71_1211 (gluQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1c
Motif
Other DBs
NCBI-ProteinID: AIN83227
UniProt: A0A088QI93
Position
1372575..1373549
Genome map
AA seq 324 aa AA seqDB search
MANSKQAITVNSSKLLPPTGRYAPSPTGRLHLGNLRTAVLAWAHARAQGGRFIVRIEDID
RQRSRPEYEAQQLADLEAIGINWDGTPVRQSERSDLYESALADLTQRGLTYPCFCTRREI
LAASSAPHGVPGQYPGTCRSLDDEHLAAKKAEFAAAGRRPSIRLKSQVREGTATDELHGE
ITAPIDDFVLQRADDMWAYNLAVVVDDAEQGVTEVVRGDDLMSSAPRQAYLAGLLGYAAP
SFVHVPLVVNSEGRRLSKRDGDVTLGEVPVGAAQRWILDSLGGGNGSDGGDGSDGGASAE
LDSIADLPEALRAGLEIPRGQVIF
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
gtggccaattcaaagcaagcgataaccgtcaacagttcaaagctcctacctcccaccggc
cgctacgccccatcgccgaccggtcggctgcacctgggaaacctgcgcaccgcagtgttg
gcctgggcgcacgcccgtgcgcagggtggccgcttcatcgtgcgtatcgaagatatcgac
cgccagcgctcccgccccgagtatgaggcgcagcagctcgccgatctggaggccatcggc
atcaactgggatggcaccccggtccgccagtcagaacgctctgacctgtatgaatccgcg
ctcgccgacctcacgcaacgcggcctgacttatccctgcttctgcacgcgccgcgaaatc
ctcgccgcctcctccgcgccccatggcgtgccaggtcagtatcccggtacgtgccgttcg
cttgacgacgagcacctcgccgcgaaaaaagccgaatttgcggcggcggggagaaggccg
tcgatacgcctgaaatcgcaggtgcgtgaggggactgcgaccgatgagctgcatggcgag
attaccgccccgatcgatgactttgtccttcagcgtgccgatgacatgtgggcctacaac
cttgcggtcgtcgtcgatgatgccgagcagggtgtcactgaagtcgtgcgtggtgatgac
ctgatgtcctcggctccgcggcaggcttacttggctggtcttttggggtatgcggcgcct
tcgttcgtgcacgtaccactggtggtgaactcggaggggcgccggttgtccaagcgtgat
ggtgacgtgactctcggcgaggtacccgtgggtgcagcgcagcggtggattctggattcg
ctcggtggcggtaacggcagtgatggtggcgatggtagcgatggtggcgcgagcgcagag
ctcgactccattgccgacctccctgaagccctgcgtgcgggtctggaaattcctcgcgga
caggtgattttctag

DBGET integrated database retrieval system