KEGG   Corynebacterium sp. ATCC 6931: DR71_1569Help
Entry
DR71_1569         CDS       T03283                                 

Definition
(GenBank) putative acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
coa  Corynebacterium sp. ATCC 6931
Pathway
coa00071  Fatty acid degradation
coa00072  Synthesis and degradation of ketone bodies
coa00280  Valine, leucine and isoleucine degradation
coa00310  Lysine degradation
coa00362  Benzoate degradation
coa00380  Tryptophan metabolism
coa00620  Pyruvate metabolism
coa00630  Glyoxylate and dicarboxylate metabolism
coa00640  Propanoate metabolism
coa00650  Butanoate metabolism
coa00900  Terpenoid backbone biosynthesis
coa01100  Metabolic pathways
coa01110  Biosynthesis of secondary metabolites
coa01120  Microbial metabolism in diverse environments
coa01130  Biosynthesis of antibiotics
coa01200  Carbon metabolism
coa01212  Fatty acid metabolism
coa02020  Two-component system
Module
coa_M00095  C5 isoprenoid biosynthesis, mevalonate pathway
Brite
KEGG Orthology (KO) [BR:coa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    DR71_1569
   00630 Glyoxylate and dicarboxylate metabolism
    DR71_1569
   00640 Propanoate metabolism
    DR71_1569
   00650 Butanoate metabolism
    DR71_1569
  09103 Lipid metabolism
   00071 Fatty acid degradation
    DR71_1569
   00072 Synthesis and degradation of ketone bodies
    DR71_1569
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    DR71_1569
   00310 Lysine degradation
    DR71_1569
   00380 Tryptophan metabolism
    DR71_1569
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    DR71_1569
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    DR71_1569
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    DR71_1569
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:coa04147]
    DR71_1569
Enzymes [BR:coa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     DR71_1569
Exosome [BR:coa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   DR71_1569
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AIN81826
UniProt: A0A088QVM6
Position
1771716..1772924
Genome map
AA seq 402 aa AA seqDB search
MSNLPAPSPNDVVILAGARTPQGKLLGQLAPLTSVELGAHAVKHAVQRSGVAPEEVQHVV
LGQVILAGAGQNPARQVAIKAGLPWNTTAEIVNKVCLSGLNAVIHAARLIRLGDADVVVA
GGQESMTHAPHVARGVRQGKSFGALKLEDTLERDGLVDSFDGVSMGTLTDGPNSDLGISR
EQQDEVAAASHQRAAKAQEDGIFAQEIAPIEIPQRKGDPVVVDTDQGIRPETTVETLAKL
RPVFLKENGTITAGNSSPISDGAAAVVLASRAYAEKHGLDYLAVVGKAGQTAGPDNSLHA
QPADSLKEALRRAEWDAQELDFIEINEAFGAVAVKSLRELDYPLEKTNIHGGAIALGHPI
GCSGARLTLTAAMELNRRGSGRAGVSLCGGGGQGDALLLYRD
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaccttccagctcccagcccgaatgatgtcgttatcctcgccggtgcccgcacc
ccgcagggcaagctgctcggccagctggcaccgcttacttccgtcgaactcggcgcacat
gctgtcaagcacgctgtccagcgttccggcgttgccccggaagaggttcagcacgtcgtt
ctgggccaggtgattctcgcaggcgctggccagaacccggcccgacaggtcgccattaag
gcaggtctgccatggaatacgaccgctgagatcgttaacaaagtctgcctctcgggccta
aacgctgtcattcacgctgctcgcctgattcgtctcggtgatgcagacgttgttgttgca
ggtggtcaggagtccatgacgcacgctccgcacgttgcacgcggtgttcgtcagggcaag
tccttcggtgcgctgaagctggaggacaccttggagcgcgacggtctggtcgactccttc
gatggtgtgtccatgggtacgcttaccgacggtccgaacagcgacctcggcattagccgc
gagcagcaggacgaagttgcggccgcttctcaccagcgtgcagccaaggcgcaggaagac
ggcattttcgcgcaggaaatcgctccaatcgagattccgcagcgcaagggtgacccggta
gttgtcgacaccgaccagggcattcgcccggagaccactgtggagaccctggctaagctg
cgtccggtcttcctgaaggaaaacggcaccatcactgccggtaactcctcgccgatttcc
gacggtgccgcagcagttgtgctggcatcgcgtgcctacgcagagaagcacggcctggac
tacctcgcagttgtgggcaaggccggccagaccgcaggtccggataactccctgcacgct
cagccggcggactctttgaaggaggctctgcgtcgcgctgagtgggacgcgcaggagctt
gacttcatcgagatcaacgaggcatttggtgcggtggccgtcaagtccctgcgtgagctg
gactacccgctggaaaagaccaacatccacggtggcgcgattgccctcggccacccgatt
ggctgctccggtgcccgcctgactctgaccgctgcaatggagctgaaccgtcgcggttcg
ggtcgcgctggtgtgtccctgtgtggtggcggcggccagggcgacgcgctgctgctgtac
cgcgactaa

DBGET integrated database retrieval system