KEGG   Corynebacterium sp. ATCC 6931: DR71_2014Help
Entry
DR71_2014         CDS       T03283                                 

Gene name
cobQ
Definition
(GenBank) cobyric acid synthase CobQ
  KO
K02232  adenosylcobyric acid synthase [EC:6.3.5.10]
Organism
coa  Corynebacterium sp. ATCC 6931
Pathway
coa00860  Porphyrin and chlorophyll metabolism
coa01100  Metabolic pathways
Module
coa_M00122  Cobalamin biosynthesis, cobinamide => cobalamin
Brite
KEGG Orthology (KO) [BR:coa00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    DR71_2014 (cobQ)
Enzymes [BR:coa01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.10  adenosylcobyric acid synthase (glutamine-hydrolysing)
     DR71_2014 (cobQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GATase_3 CbiA AAA_26 Peptidase_S51 GATase Peptidase_C26 SNO MobB
Motif
Other DBs
NCBI-ProteinID: AIN82823
UniProt: A0A088QHM7
Position
2267676..2269142
Genome map
AA seq 488 aa AA seqDB search
MQAPAALIAGCTSDAGKSVLVAGMCRLLARRGVRVAPFKAQNMSNNCAVTLDGGEIGRAQ
ALQALACGLEPDVSFNPVLLKPGSDHTSQVVVKGKADGHASALTYRSRRKALRGVVAETL
EELRGQFDVVLCEGAGSPAEVNLRESDIANMGLAELADLPVVVAGDIDRGGVLAHFVGTH
AILSPEDRARITGFIVNKFRGDVSLLMPGLDVVREYTGVPVLGVVPFIPGLWIDAEDSLG
TVAGASVGPANAPLGTETLSVAAIRLPRVSNATDIEALACEPGVHVQWTVDPSVVARADL
VVLPGTKSTVADLKWLRERGLDDVLENRAARGLPLIGICGGFQMLCTTITDSVESAAGTV
NGLGVFDTDIEFAGTKTLVSHPDGSYEVHNGQVVRSSEHPFITEPEEEGARRGMVMGTHR
HGYLENDQARRELLMEVAVAVGRDGFEVSSTTSFAAERLWQVDMLADAVEEYLAGPALAQ
ATGIEQLG
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
gtgcaggctcctgcagctctgattgccggctgcacctcagatgccggtaagtcggttctg
gtcgccggcatgtgtcggttgctcgcgcgacgcggagtgcgcgtcgcgcccttcaaggcg
caaaacatgtccaacaattgcgctgtcacgctcgacggcggcgagattgggcgcgcgcag
gctctgcaggcgttggcctgtgggctggagccggatgtctcctttaacccggtgcttctc
aagccgggctcggaccacaccagtcaggtggtggtgaagggcaaggctgatgggcatgcg
agcgccctgacgtaccggtcgcggagaaaagcgctgcgcggagtagttgcggagacattg
gaagagctgcgggggcagttcgatgtcgtcctgtgtgaaggcgctggtagtcctgccgag
gtcaatctgcgggagtcagacattgccaacatggggttggcagagctcgctgatttgccg
gttgtggtcgccggtgacattgaccgcggtggggtgcttgcacatttcgtcggcacgcat
gcaattttgagccccgaagaccgcgcgcgaattaccggttttattgtcaacaagttccgg
ggcgatgtttcgctgttgatgccgggattggacgtagtgcgtgagtacaccggtgtgccc
gtactcggcgtggtgccgtttattccggggctgtggatcgatgcggaggattcgctcggc
acagtcgctggtgcgtcggtagggccggcgaacgcaccgctgggcacggaaacgttgtcc
gtggccgccattcgcttgccgcgcgtgtccaacgccaccgatatcgaggcgcttgcctgt
gaaccaggggtacacgtgcagtggacggtcgatccgtcggtcgttgctcgcgccgacctg
gtcgtgttgcccgggacgaagtcgacggtcgccgatctcaagtggttgcgcgagcgtggg
cttgacgacgtacttgagaaccgagccgcccgggggctaccgctgattggcatctgcggt
gggttccaaatgctctgcaccaccatcactgactcggtggagtcggcagccgggaccgtg
aacgggcttggcgtgttcgataccgacattgaattcgcggggacgaagacactggtgagt
cacccggatggctcgtacgaagtgcacaatggacaggttgtgcgaagcagtgaacatcct
tttatcactgagcctgaagaagaaggggcgcggcgtggcatggtgatgggtacgcaccgc
cacggctacctggaaaatgatcaggcgcgccgtgagttgctgatggaagtggcagttgcc
gtcggtcgggacggcttcgaggtcagctctactacttcgtttgccgcagaacggctgtgg
caggtcgacatgttggccgatgcagtcgaggagtacctggctgggccggcattggcccag
gccacaggtattgagcagctaggctag

DBGET integrated database retrieval system