KEGG   Caldicellulosiruptor obsidiansis: COB47_0089Help
Entry
COB47_0089        CDS       T01293                                 

Definition
(GenBank) Glucosylceramidase
  KO
K01201  glucosylceramidase [EC:3.2.1.45]
Organism
cob  Caldicellulosiruptor obsidiansis
Pathway
cob00511  Other glycan degradation
cob00600  Sphingolipid metabolism
cob01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cob00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    COB47_0089
  09107 Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    COB47_0089
Enzymes [BR:cob01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     COB47_0089
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_30 Glyco_hydro_59 Glyco_hydro_30C Melibiase Cyc-maltodext_C Thionin
Motif
Other DBs
NCBI-ProteinID: ADL41462
UniProt: D9TH97
Position
107794..109137
Genome map
AA seq 447 aa AA seqDB search
MFKKIASYVTAKDQSIPMQQVDNIKECQKIKNETIITIDPSCTFQEVIGFGGALTEAAAV
NILSLLPQQQEEILRGYFDPKDGLGYKLCRIHMNSCDFCTDSYSCDDVEGDTDLKYFNIE
RDKKMVIPLLKRIKEYCPDLKILVSPWSPPAWMKTNGDMCHGGKLKDEYKKTWARFFCKF
IKAYKEEGIDIWAVTVQNEPMATQVWESCIYTAEEERDFVKDYLGPTLEEEGLSHIKILI
WDHNKDIIYDRVKTILSDKDAAKYVWGVAFHWYGGDHFDQLKKIKEEFPYVNLVFTEGCQ
EGGVKLGSWELGERYAHEIIGDFNSYTIGFMDWNIVLDTVGGPNHVGNFCDAPIVVDKNE
KKIYYQNAYYYIGHFSKFIKPGAKIVASNCNNPKLEVLVGRNNDNSLVIVIFNKNQEEIE
FGIKIAGEIFSGKSSARSISTIILQNQ
NT seq 1344 nt NT seq  +upstreamnt  +downstreamnt
atgtttaaaaaaattgcaagttacgtaactgccaaggatcagagtattcctatgcagcaa
gtagacaatataaaagagtgccaaaaaataaaaaatgagactattataacaattgatcca
tcttgtacatttcaagaggtaataggatttggaggagcacttacggaggctgccgcggta
aatatactgtcacttttaccccagcaacaagaagagattttaagaggttactttgatcca
aaagatgggcttggctacaaactctgtagaatccatatgaacagctgtgatttttgtaca
gacagctatagctgtgatgatgttgaaggtgatactgatcttaaatattttaacattgag
agagacaaaaagatggtaattcctcttttaaaaagaataaaggaatattgtccagatctc
aaaattcttgtttcaccttggagtccgcctgcatggatgaaaacaaacggtgatatgtgc
catggtggaaagctaaaggatgagtataaaaaaacatgggcaagatttttctgcaaattc
ataaaagcatataaagaagaaggaattgatatatgggcagtgacagttcaaaatgagcct
atggcaactcaggtgtgggagtcgtgtatatacacagctgaagaagaaagagattttgtg
aaggattacttagggccaactcttgaggaagaagggctttcccatataaaaatacttata
tgggaccacaacaaagatatcatatatgatagggtaaaaacaattttgagtgacaaagac
gctgcaaagtatgtgtggggagttgcattccactggtatggaggggaccattttgaccag
ctcaaaaaaataaaagaagagtttccttatgtcaatttagtgtttaccgaaggttgtcag
gaaggtggagtaaagcttggttcctgggagcttggagaaaggtatgctcatgagataatt
ggagattttaacagctacacaattggatttatggattggaatattgttcttgacacagtt
ggaggtcccaatcatgttggcaatttttgcgatgccccgatagttgttgataaaaatgag
aaaaagatttactatcaaaatgcatattattatattgggcatttttcaaaatttataaag
ccgggagctaaaattgtcgcaagtaattgtaataatccaaaacttgaagttttagtaggc
agaaataatgataatagcttggtaatagttatttttaacaaaaatcaggaagaaatagaa
tttggtataaaaatagctggagaaatctttagcgggaaatcttctgcgaggtctatttct
acaattattttacaaaatcaatag

DBGET integrated database retrieval system