KEGG   Caldicellulosiruptor obsidiansis: COB47_0651Help
Entry
COB47_0651        CDS       T01293                                 

Definition
(GenBank) catalytic domain-containing protein of components of various dehydrogenase complexes
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
cob  Caldicellulosiruptor obsidiansis
Pathway
cob00010  Glycolysis / Gluconeogenesis
cob00020  Citrate cycle (TCA cycle)
cob00620  Pyruvate metabolism
cob01100  Metabolic pathways
cob01110  Biosynthesis of secondary metabolites
cob01120  Microbial metabolism in diverse environments
cob01130  Biosynthesis of antibiotics
cob01200  Carbon metabolism
Module
cob_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:cob00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    COB47_0651
   00020 Citrate cycle (TCA cycle)
    COB47_0651
   00620 Pyruvate metabolism
    COB47_0651
Enzymes [BR:cob01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     COB47_0651
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding CAT Biotin_lipoyl_2
Motif
Other DBs
NCBI-ProteinID: ADL41966
UniProt: D9TIY4
Position
760023..761381
Genome map
AA seq 452 aa AA seqDB search
MATPVIMPKQGQTVESCIITKWYKKKGDKVEVGDLLFSYETDKASFDEEAKVSGVLLDIF
FEEGEEVPVLTNVCVIGEPGEDVQHFNPKASSEVQKVHISHQTYEQDVPGETQTKISKHY
SPIEGKIKISPRAKNLAEKLNVDFRFAKPSGPDGRIIERDILKLFESGPVFTSAATQEAK
EVEDVQILEPTGIGGRITTFDIERAKQESYVSKISESSGQNVEYEDVPLSNIRKAIAKAM
YLSLTTTAQLTLHTSFDASKILEFRKKVKENREKLELEDITINDIILFAVSRVLPKHKLL
NSHFLDDKMRYFKNVHLGFAVDTERGLMVPTIFNCNQKTLSQISKEAKELIGLCRKGTIS
PDLLKGATFTITNLGSFGIESFTPVLNPPQTGILGVNTIVQRSKEENGQIKFYPAMGLSL
TFDHRALDGADAARFLKDLKELLENFDLLLAL
NT seq 1359 nt NT seq  +upstreamnt  +downstreamnt
atggcaacacctgtaataatgcccaaacagggacagactgttgaaagttgtataattaca
aagtggtataagaaaaaaggtgataaggttgaagttggcgaccttttattttcttatgag
accgacaaggcgagttttgatgaggaagcaaaggtaagtggtgtacttcttgatatcttc
ttcgaagaaggtgaagaagttcctgtcttaactaatgtgtgtgtgattggtgaacctggt
gaggatgtgcaacatttcaatccaaaggcttcctcagaagtccaaaaagttcacatctca
caccagacgtatgagcaagatgtcccgggggaaactcaaacaaagatttcaaagcactat
tctccaattgaagggaaaataaaaatttcacccagagcaaagaacttagctgaaaaatta
aatgttgattttaggtttgcaaaaccttcagggccagatggaagaataattgaaagagac
attttgaaactttttgaatcagggccagtgtttacaagtgcggcaacacaggaagcaaaa
gaagttgaagatgttcaaattttagagccaactggcattggtggtagaattacaactttt
gacattgaaagggcaaagcaggaaagctatgtctcaaaaatttctgagtcttctgggcag
aatgtagaatatgaagatgtgccgctttcaaatatcagaaaggctatcgcaaaggctatg
tatctatctcttaccacaacagctcagctgacattacacacatcatttgatgcaagtaaa
atccttgagttcaggaaaaaagtgaaagaaaacagagaaaaactggagcttgaggatatc
acaataaacgatataatcctttttgctgtctcaagggttttaccaaaacacaaattgctc
aatagccattttttggatgataaaatgagatatttcaagaatgttcatcttgggtttgca
gttgacacagagcgtggtcttatggtaccaacaatattcaactgtaaccaaaagacctta
agtcaaatctcaaaagaagcaaaggagctaattggcctttgcagaaaaggaacaatctca
ccagaccttttaaaaggtgcaacgttcactattaccaatttaggaagttttggtatagaa
agttttacacctgtcctaaatcctcctcagacagggattttgggtgtaaatacaattgtt
cagaggtctaaggaagaaaatggacagataaaattctaccctgcaatggggttgtcacta
acgtttgatcacagagcgttagatggagccgatgcggcaaggtttttgaaggatttaaag
gagcttttagaaaactttgatttgcttttggcactctga

DBGET integrated database retrieval system