KEGG   Caldicellulosiruptor obsidiansis: COB47_0758Help
Entry
COB47_0758        CDS       T01293                                 

Definition
(GenBank) Aldehyde ferredoxin oxidoreductase
  KO
K03738  aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5]
Organism
cob  Caldicellulosiruptor obsidiansis
Pathway
cob00030  Pentose phosphate pathway
cob01100  Metabolic pathways
cob01120  Microbial metabolism in diverse environments
cob01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cob00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    COB47_0758
Enzymes [BR:cob01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.5  aldehyde ferredoxin oxidoreductase
     COB47_0758
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AFOR_N AFOR_C YcbB
Motif
Other DBs
NCBI-ProteinID: ADL42070
UniProt: D9TJ88
Position
882270..884030
Genome map
AA seq 586 aa AA seqDB search
MIGKDFIRVLYIDLTNKKADIQEREDLYKYLGGAGVAAKLLEENMKKGVDPLHESQPLII
SIGPLSTIFPVVTKAVATFVSPHTGEYGESHAGGRLAMAIRNAGYDAIVITGKAQKPTYL
VITDKNIEFKDARAMWGLDIEETGRVIREREPGPGKRSIIRIGRAGENLVTYSCVNVDTY
RHFGRLGIGAVFGSKNLKAMMIMGEEDLPISNLKEYFKTYQEIYKKVTQTDAMAKYHELG
TPMNIKVLNSISSLPTKNLLQSTFEHADDISGETFAEKNLVRKVSCVGCPIGCIHIGQFR
REFDKGYEYESIAVSYDHELIYALGSLLGIKTTDEVLQIIDEVELAGLDAISTGVVLAWA
TEALKKGLISREDTLADLEFGNTMEYVKAIDNIADRVNEFYYTIGKGLKEAVKKYGGEEF
ALLYGGNEMAGYHTGYAFALGQTVGARHSHLDNAGYSYDQSAKELKDEEIIDYVINEEKE
RAVLTSLCICLFARKVYDRSTILKALNAVGINWTNDDLTRLANDVFFTKLKIKKELGYSL
ENYKFPKRIFETPTMWGKMDEERLNRLLKMYIERVEKEYEDWSRGK
NT seq 1761 nt NT seq  +upstreamnt  +downstreamnt
atgataggcaaggactttataagagtgctttatattgaccttacaaacaaaaaagcagat
attcaagaaagggaggatctttacaaatacttaggcggagcaggtgttgcagcaaaactt
ttagaggaaaatatgaaaaaaggtgttgaccctttgcatgaaagccagcctctcattata
tctataggacctctttcaactatctttcctgttgtgacaaaagctgttgctacttttgtc
tcaccccatacaggagaatacggggaaagtcatgcaggtggcagacttgcaatggctata
agaaatgcagggtatgatgcaatagttataacaggaaaagctcaaaagcccacatacctt
gtcattacagataagaatattgaatttaaagatgcaagagctatgtggggacttgacata
gaggagacaggaagggttataagagaaagagagccaggtccagggaaaagaagtataatc
agaattggcagggcaggcgaaaaccttgtaacatactcttgtgtcaacgttgatacttac
agacattttggaaggcttggcataggagcagtctttggaagcaaaaacctcaaagcgatg
atgataatgggcgaagaggatttgcctatttcgaatttaaaagagtactttaagacttat
caggagatatacaaaaaagttacacagacagatgcaatggcgaagtatcatgagcttggg
acacctatgaacatcaaagtgctaaacagcataagttctcttccaactaagaatttactt
cagtctacatttgagcatgcggacgatatctcaggtgagacgtttgccgaaaagaacctg
gtcagaaaggtttcgtgtgttggctgtcccattggatgcatccatatagggcagttcaga
cgcgagtttgacaagggatatgagtatgagtctattgctgtatcgtatgaccatgaactt
atatatgctttaggtagtcttttaggaataaaaacaactgatgaggtccttcagattatt
gatgaggtagaacttgcaggacttgatgctatctcaacaggtgttgtattggcatgggca
acagaagcactcaaaaaaggtcttatctcaagagaagacactcttgctgaccttgagttt
ggcaacaccatggagtatgtaaaagcaattgacaatattgcagacagggtaaacgagttt
tactacacaattggcaaaggtctcaaagaggctgtgaaaaaatatggaggagaagagttt
gcacttttgtatggtggcaatgagatggcaggatatcatacaggctatgcatttgcgctt
ggtcaaacagttggtgcaaggcattctcacttagacaatgcaggttactcttatgaccag
agcgcaaaagaattaaaagatgaggaaataatagattatgtgattaatgaagagaaggaa
agagcagtgctcacatcgctgtgcatatgtctatttgcacgaaaggtgtatgacaggtca
actatcttgaaagcattaaatgcggttggtataaactggactaatgatgaccttacacga
cttgcaaatgacgtattttttactaaactaaaaatcaaaaaggagcttggatattcactt
gaaaattataaatttccgaagagaatatttgaaacacctacaatgtggggaaagatggat
gaagagaggttaaataggcttttgaagatgtatatcgagagggtggaaaaagaatatgaa
gattggagtagaggtaaatag

DBGET integrated database retrieval system