KEGG   Caldicellulosiruptor obsidiansis: COB47_1148Help
Entry
COB47_1148        CDS       T01293                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K00927  phosphoglycerate kinase [EC:2.7.2.3]
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
cob  Caldicellulosiruptor obsidiansis
Pathway
cob00010  Glycolysis / Gluconeogenesis
cob00051  Fructose and mannose metabolism
cob01100  Metabolic pathways
cob01110  Biosynthesis of secondary metabolites
cob01120  Microbial metabolism in diverse environments
cob01130  Biosynthesis of antibiotics
cob01200  Carbon metabolism
cob01230  Biosynthesis of amino acids
Module
cob_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
cob_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:cob00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    COB47_1148
   00051 Fructose and mannose metabolism
    COB47_1148
   00562 Inositol phosphate metabolism
    COB47_1148
Enzymes [BR:cob01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.3  phosphoglycerate kinase
     COB47_1148
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     COB47_1148
Exosome [BR:cob04147]
 Exosomal proteins
  Proteins found in most exosomes
   COB47_1148
  Exosomal proteins of colorectal cancer cells
   COB47_1148
  Exosomal proteins of bladder cancer cells
   COB47_1148
  Exosomal proteins of melanoma cells
   COB47_1148
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PGK TIM SIS_2 DREPP
Motif
Other DBs
NCBI-ProteinID: ADL42447
UniProt: D9TKB5
Position
1269556..1271508
Genome map
AA seq 650 aa AA seqDB search
MPKLNKKTIRDIDVAGKRVLVRVDFNVPQDENGNITDDRRIREALPTIKYLIDHNAKVIL
VSHLGRPKGKFDPKYSMAPVAKRLSELLGKEVVLAKDVIGDDAKKCVEQMKEGDVVLLEN
VRFHKEEEENDREFAKALASLADIYVNDAFGTAHRAHASTAGVAEFLPAVAGFLMEKEIE
MLGNALANPQRPFVAILGGAKVSDKIGVITNLLEKVDSLLIGGAMAYTFLKAKGYKIGKS
KCEDDKLDVAREIMKKAEEKGVNLLLPVGSIVAKEFKNDTEFMYVPSDAMPDDMMGMDIG
NTTIELFSKEIKKAKTIVWNGPMGVFEFPNFAKGTEAIARAVAEAVEENGAIAIIGGGDS
AAAVEKLGFADKMTHISTGGGASLEFLEGKVLPGIACLLDKNPRKKIIAANWKMNKTPQE
AKEFVEELKKYIDDVQAEVVICAPSILVPYVKEAIEGTNIKLGTQNMFYEEKGAYTGEIS
GPMLKEVGVEYVVIGHSERRQYFGETDEIVNKKVLAALKFGIKPIVCVGETLKQREYGIT
DELVRLQVKIALNGVSKEDVEKVVIAYEPIWAIGTGKNATPEEANRVIGVIRNVIAEMYD
EDTAQKVRIQYGGSVNSANSAEIFNMPEIDGGLVGGASLNAQEFAKILHY
NT seq 1953 nt NT seq  +upstreamnt  +downstreamnt
atgcctaagctaaataagaagaccataagagatatagatgttgccggtaaaagggttctt
gtgagggttgactttaatgttcctcaagatgaaaatggcaatatcactgacgatagaaga
ataagagaggctcttcctacaataaagtatctcattgaccacaacgcaaaggtaatttta
gtatcccatttgggaagaccgaagggcaaatttgacccgaaatactcgatggctcctgtt
gcaaaaagactttctgagcttctcggcaaggaagttgttcttgcaaaagacgttataggc
gatgatgcaaaaaagtgtgttgaacagatgaaagaaggagatgtagttcttcttgaaaat
gtcagatttcacaaagaggaagaggaaaatgatagagaatttgcaaaggcgttagcatct
cttgcagacatttatgtaaacgatgcatttggtacagctcacagagcacatgcatcaaca
gcaggtgttgcagagttcttaccagcagttgctgggttcttaatggaaaaagagatagaa
atgcttggcaatgctcttgcaaatccgcaaagaccttttgttgcaatcttgggtggcgca
aaagtttctgacaagattggggttattacaaatcttcttgaaaaggttgatagcctctta
attggcggtgcaatggcttataccttcttgaaagcgaaaggatataaaatcgggaagtca
aaatgtgaagatgacaagcttgatgttgcaagagagataatgaaaaaggcagaggaaaaa
ggagtaaaccttcttttgcctgttggaagcatagtagcaaaagaatttaaaaatgataca
gagtttatgtatgtaccatcagatgcaatgccagacgatatgatgggtatggacatagga
aatactacaattgagctattctccaaggagataaagaaggcaaagacaattgtttggaac
ggaccaatgggtgtatttgaatttccaaactttgcaaagggaacagaagctatcgcaaga
gctgttgctgaggctgttgaagaaaatggtgcaattgcaattatcggtggtggcgactct
gcagctgctgtcgaaaaacttgggtttgctgataagatgacacatatctcaacaggtggc
ggtgcttcattagagttcttggaaggtaaagttttaccaggtattgcatgtcttcttgat
aaaaatccaaggaagaagataatcgcagcaaactggaagatgaacaaaactccacaagaa
gcaaaagagtttgttgaagagctgaagaagtatattgatgatgtgcaggcagaagtagtt
atctgtgctccatcaattcttgttccttatgtcaaagaagcaatagaaggaacaaatata
aaactcggaacacaaaacatgttctatgaagaaaaaggtgcatatacaggtgagatctcc
ggtccaatgttaaaggaagttggagttgagtatgtggtaattggtcactctgaaagaagg
cagtactttggtgaaacagacgaaattgtgaacaaaaaagttctggcagcgctgaaattt
ggtataaaacctattgtatgtgtcggtgagactttaaagcaaagagaatatggtattact
gacgaacttgtaagacttcaagtaaagattgcactgaatggtgtttctaaagaagacgtt
gaaaaggttgtcattgcatatgagcctatctgggcaataggtacaggcaagaatgcaaca
cctgaagaggcaaatagagtaattggggttatcagaaatgtaattgcagagatgtacgat
gaagatactgcgcaaaaggttagaatccagtatggtggtagtgtaaactctgcaaattca
gcagagattttcaatatgccagagattgatggaggattagttggcggtgcaagccttaat
gctcaggaatttgcaaagatattacactactaa

DBGET integrated database retrieval system