KEGG   Caldicellulosiruptor obsidiansis: COB47_1421Help
Entry
COB47_1421        CDS       T01293                                 

Definition
(GenBank) glycoside hydrolase family 4
  KO
K07406  alpha-galactosidase [EC:3.2.1.22]
Organism
cob  Caldicellulosiruptor obsidiansis
Pathway
cob00052  Galactose metabolism
cob00561  Glycerolipid metabolism
cob00600  Sphingolipid metabolism
cob01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cob00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    COB47_1421
  Lipid metabolism
   00561 Glycerolipid metabolism
    COB47_1421
   00600 Sphingolipid metabolism
    COB47_1421
Enzymes [BR:cob01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     COB47_1421
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_4C Glyco_hydro_4 Methyltransf_12 AsnC_trans_reg
Motif
Other DBs
NCBI-ProteinID: ADL42711
UniProt: D9TL29
Position
complement(1537342..1538658)
Genome map
AA seq 438 aa AA seqDB search
MLKIAIIGAGSGVFTRNLVRDILSYPELRDCTIALMDIDSIRLEFMRKALQKLIDQEKYS
TRLEATTDRKEALKGAKYVIVTIQVGGLKPYEYDIYIPLKYGVKQAVGDTIGPGGVFRAL
RTIPVLLDIAKDMEELCPDALLLNYVNPMAMNCWALNKATNIKNVGLCHSVQGTAEFLAK
IIGAKMEEISYLCAGINHMAWFLKFEWNGKDAYSLIREKANDPEIYTQDVTKFEILKHFG
YYVTESSFHMSEYVPYFRKSDDWINRIHKTHSWHKEHYNGMYLHCCLDAAKTLLEDLKKM
AEADYIDPKRSSEYCATIIHSIETNTPSVINGNVENKGLITNLPEGCCVEVPCLVDRNGI
QPTYVGDLPPQLAALNRTNINVQELAVIAALTGDREAVYHAIMMDPLTSAVLDLDQIRQM
VDEMFEAEKEWLPEGFYR
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
atgctcaaaatagctatcataggtgcaggaagtggagtttttacaagaaacctggtaaga
gacattttgtcgtacccagagttaagagactgtacaatagcgcttatggacattgacagt
ataagacttgaatttatgagaaaagctttgcaaaaactcattgatcaggaaaagtattct
acccggcttgaagccacaactgatagaaaagaagctctaaaaggtgcaaaatatgtgatt
gtcacaatacaagttggaggtttaaaaccttacgaatatgacatttacattcctctaaaa
tacggtgtaaaacaggcagttggtgatacaataggtccagggggagttttcagggctctt
agaacaataccggttttgcttgacattgcaaaggacatggaagagctgtgtccagatgct
cttcttcttaactatgtaaatccaatggcaatgaattgctgggcattaaataaggctacg
aatataaaaaatgtagggctttgtcatagtgttcaaggaactgcagaatttttagcaaag
attattggggcaaagatggaagagatttcatacttatgtgcaggtataaaccacatggca
tggtttttaaaatttgagtggaatgggaaagatgcatattctcttataagagaaaaagca
aatgaccccgagatttatacccaggatgttacaaaattcgagatattaaagcattttgga
tattatgtaactgagtcaagttttcacatgtctgaatatgttccctattttagaaagagt
gacgattggataaatagaatccataaaacccattcatggcacaaagaacattacaatggc
atgtatttgcattgctgcttagatgctgcgaaaactttacttgaagacctgaagaaaatg
gcagaggcagactacatcgaccctaaaagaagtagcgaatactgtgcaactatcatccat
tcaatagagacaaatacgccaagcgtaataaatggtaatgttgagaataagggtttgata
acaaatttacctgaaggatgctgcgtagaagtaccatgtttggttgacagaaatggtatt
cagccaacttatgtaggggatcttccaccacagcttgcagctttgaacagaacaaatata
aatgttcaagagcttgctgtgattgcagctttgacaggtgatagggaggcagtttatcat
gcgattatgatggatcctctcacaagtgctgttttggatttggaccagatacgtcagatg
gttgatgagatgtttgaagctgaaaaagaatggctgccagaagggttttataggtaa

DBGET integrated database retrieval system