KEGG   Capnocytophaga ochracea: Coch_0055Help
Entry
Coch_0055         CDS       T00961                                 

Definition
(GenBank) GTP cyclohydrolase I
  KO
K01495  GTP cyclohydrolase IA [EC:3.5.4.16]
Organism
coc  Capnocytophaga ochracea
Pathway
coc00790  Folate biosynthesis
coc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:coc00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Coch_0055
Enzymes [BR:coc01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     Coch_0055
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_cyclohydroI DUF1598
Motif
Other DBs
NCBI-ProteinID: ACU91620
UniProt: C7M4J0
Position
complement(72152..72823)
Genome map
AA seq 223 aa AA seqDB search
MNKNQEEDILGDNHIATSAVTPLRADAFQMSETEKIAEIETHVRAILHTLGMDLTDDSLK
GTPKRVAKMFVKEIFGGLLPERKPSMSTFENSYHYGEMLVEKNIVVYSTCEHHLLPIVGR
AHVGYISNGKVLGLSKMNRIVEYYAKRPQVQERLTMQIVQEMQRALGTEDVACIIDAKHL
CVNSRGIEDIDSSTVTAEFGGKFKDPEVRKEFLEYIKLDTRFH
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
atgaataaaaatcaagaagaagatatattaggagataaccatatagcaacttcggcagtt
acaccactcagagcagatgcttttcagatgagtgaaaccgaaaaaatagcagaaatagaa
actcacgtacgtgctattttacatactttgggaatggatttaaccgatgatagtttgaaa
ggcactcccaagcgtgtagctaagatgtttgtaaaagagatttttggaggcttattacca
gagcgcaaaccttcgatgtctacttttgagaactcttaccattatggtgagatgttggta
gagaagaatatcgtggtgtattccacttgtgaacaccacttgttacctattgtagggcgt
gctcacgtgggctatatttctaacggtaaagtgttagggctttcgaagatgaatcgtatt
gtagagtactatgcgaaacgtccgcaagtgcaggaacgccttactatgcaaatagtacaa
gagatgcaacgcgctctcggcaccgaagatgtggcttgtattatagatgccaaacaccta
tgtgtgaactctcgcggtatagaagatattgatagcagtacggttactgctgagtttgga
ggtaaattcaaagaccctgaggtaagaaaggagttcttagaatatatcaaattagacacg
agattccattaa

DBGET integrated database retrieval system