KEGG   Capnocytophaga ochracea: Coch_1009Help
Entry
Coch_1009         CDS       T00961                                 

Definition
(GenBank) Glycoside hydrolase family 42 domain protein
  KO
K12308  beta-galactosidase [EC:3.2.1.23]
Organism
coc  Capnocytophaga ochracea
Pathway
coc00052  Galactose metabolism
Brite
KEGG Orthology (KO) [BR:coc00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Coch_1009
Enzymes [BR:coc01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     Coch_1009
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_42 Glyco_hydro_42M Cellulase Glyco_hydro_10 DUF4434 AP_endonuc_2
Motif
Other DBs
NCBI-ProteinID: ACU92564
UniProt: C7M3X9
Position
complement(1178966..1180969)
Genome map
AA seq 667 aa AA seqDB search
MFLRSYIWLLLLGIASITTTVKAQPYISPIGAQVFIEPGQTDEEINTWFKLLSEHQMNCC
RIRMFENYMKRPDGTWDFSLFDKAFKAAERYNVKIVGTLFPAAPDNSLGGFKHPYSQSHL
QEIATYIKQVVTHFKTSPALYGWVLMNEPGTGGWVPNDAFGNAQKSEWLKTLKPTAYNSK
GYPQIVDFTPQQFLLHYNTWYLQWIANEVKKYDPNAYLHVNSHQIFSNIAEYNFPAWRNF
LSSLGASAHPSWHYTMLHRNQYATALGANCAIIRSGAGELPFWVTELQGGNNTFSGYKAF
CPTKEEITQWLWTSVGNGAEHILFWCLNPRAVGDEAGEWALVDFQNQPTDRLTAASEVAK
TLRKINISKFKPVVANIHILYTRETLWIEKKAQLNDNTNNDYEGRNTGGAMKSAFAMYET
LLENGINSQFQCFDEFNWNKPSYKGETIILSGQISLPSRYWEPLRNFVHNGGKLVMEGLS
AFYDENMFALHHTGFPLQDVLGGALKEVKCLPTDFSVNYQNAPLPAHLWKGSIYNTQGQI
VTQEGNSVLATRHRFMRGETFWFPSLLGLGALRSGKGEALSRLLLAEAQATVPFQFETYQ
KGVQMYTMQKGNQYLTILINKRPQATSVALRYPKGVNPSVVFADKGGSATANTARLSSEE
TLVILWK
NT seq 2004 nt NT seq  +upstreamnt  +downstreamnt
atgtttttaagaagttatatatggcttttattacttgggattgcctccatcactaccact
gtgaaagcgcaaccctacatatcacccattggtgcacaggtgttcatagagcctggtcaa
accgatgaggagataaatacttggttcaaactcctcagcgagcaccaaatgaactgttgt
cgcattcgtatgttcgagaactatatgaagcgccccgacggtacttgggatttctctctt
tttgacaaggcttttaaagcagcagagcggtacaatgtaaagattgtaggcacactcttc
cccgctgcccccgacaattcgttaggtggctttaaacacccttattcccagtcacatcta
caagaaattgctacctatatcaagcaagtagtaacccatttcaaaacctcgcctgccctc
tatggttgggtgctaatgaacgaacctggcacagggggttgggtgcctaacgatgccttt
ggcaatgctcaaaaaagtgaatggctcaaaacactaaaacctactgcctacaacagcaaa
ggctacccacaaatagtagatttcacccctcaacagttcttgctacactacaacacttgg
tacctgcaatggattgccaacgaggtgaaaaagtacgaccctaatgcctatttgcacgtc
aattctcaccaaatattcagcaatattgccgaatacaacttccccgcttggcgcaacttc
ctcagttcgttaggcgcttctgctcaccccagttggcattacactatgcttcacagaaat
cagtatgctacagctttgggggcaaattgcgctatcatacgttcgggagcaggcgaattg
cctttttgggtaaccgaattgcaaggaggcaacaacactttcagcggttataaagccttc
tgtcctaccaaagaagaaatcacccaatggctgtggacgagcgttggcaatggtgctgaa
cacatcttgttttggtgcttgaacccgcgtgctgtgggcgatgaagcaggcgaatgggca
ctcgtagatttccaaaaccaacctaccgaccgactcactgctgcctccgaagtcgccaaa
acactccgaaaaatcaatatcagcaaatttaaacccgtagtagccaacattcatatcctc
tatacccgcgaaacgctttggatagaaaagaaagcgcaactaaatgataataccaataat
gattacgagggcagaaacacgggaggtgctatgaaatcggcgtttgcaatgtacgaaacc
ctacttgaaaacggtatcaatagtcagtttcagtgctttgatgagttcaactggaacaaa
ccctcttacaaaggcgaaaccattattttatcaggacaaataagcctaccatcgcgttat
tgggaacccctgcgcaactttgtacacaatggtggcaaactggtaatggaaggactcagt
gcgttctacgacgaaaatatgtttgccctacatcacacaggatttccgctacaagatgta
ttgggaggagcactgaaagaagtaaaatgcctccctaccgatttcagtgtaaattaccaa
aacgcacccctgcccgcccacctttggaaagggagtatctacaatactcaagggcaaata
gtaacccaagaggggaatagtgtgttggcaacgcgacatcgctttatgaggggagaaacc
ttttggtttccatcactattggggttgggcgctttgcgcagtggcaaaggggaagcgctt
tcgcgtttgctactcgccgaagcgcaagcgacagtcccttttcagtttgaaacttaccaa
aaaggagtgcaaatgtatacaatgcaaaaaggtaatcaataccttacgatactcatcaac
aaacgcccacaagctacctcagtggcattgcgctaccccaaaggagtaaatccttcggtc
gtttttgccgataagggaggaagtgcaacagctaacaccgcccgtctatcctctgaagaa
acgctggtgattctttggaaatag

DBGET integrated database retrieval system