KEGG   Capnocytophaga ochracea: Coch_1445Help
Entry
Coch_1445         CDS       T00961                                 

Definition
(GenBank) CDP-alcohol phosphatidyltransferase
  KO
K00995  CDP-diacylglycerol---glycerol-3-phosphate 3-phosphatidyltransferase [EC:2.7.8.5]
Organism
coc  Capnocytophaga ochracea
Pathway
coc00564  Glycerophospholipid metabolism
coc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:coc00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    Coch_1445
Enzymes [BR:coc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.8  Transferases for other substituted phosphate groups
    2.7.8.5  CDP-diacylglycerol---glycerol-3-phosphate 1-phosphatidyltransferase
     Coch_1445
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CDP-OH_P_transf DUF4034
Motif
Other DBs
NCBI-ProteinID: ACU92991
UniProt: C7M6C5
Position
complement(1696404..1697006)
Genome map
AA seq 200 aa AA seqDB search
MKTPYLLIAFRFLLAPTILIFSYYTEESIARLWIIVFIILGLLSDIFDGIIARQMGISTV
KMRRMDSQTDLVFWLSIGIACYHLNPELIKTYRYEVIAIFIMEGLCYTISFLKFGKETCT
HAFLSKLWGLCLLTAFISLIGFGHGGFPLQLAIYWGLFSQLDVILILLLLPKWQNDIPSA
YHAYLIRRGKNFKKSKWLNS
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgaagacaccttacttactaatagccttccgttttttattagcccctaccatactgatc
ttttcttattacactgaagaatcaatagcaaggctatggattatagttttcatcatcctt
ggcttactctccgatattttcgatgggattatcgcaaggcaaatgggtattagtacagta
aaaatgcgacgaatggatagccaaacagatttagtattctggctctctataggaatagcg
tgttatcatcttaaccctgaactcataaagacgtatcggtatgaagtaatcgctattttt
ataatggaagggttatgttatactattagttttctgaagtttggcaaagaaacctgtact
cacgcttttctctccaagttgtggggcttgtgcttacttacagcatttatctccctcata
ggctttggtcacggaggatttcccttgcaattagctatttattgggggctcttctcacaa
ttagatgtgattcttatcttgcttttgttgcctaaatggcaaaacgatatccctagtgcc
tatcacgcctacttaataagaagaggcaaaaactttaagaagagcaaatggcttaatagc
taa

DBGET integrated database retrieval system