KEGG   Capnocytophaga ochracea: Coch_2168Help
Entry
Coch_2168         CDS       T00961                                 

Definition
(GenBank) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
coc  Capnocytophaga ochracea
Pathway
coc00230  Purine metabolism
coc01100  Metabolic pathways
Module
coc_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:coc00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Coch_2168
Enzymes [BR:coc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     Coch_2168
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_33 AAA_18 AAA_16 AAA_19 T3SS_needle_E cobW AAA AAA_22 CbiA
Motif
Other DBs
NCBI-ProteinID: ACU93712
UniProt: C7M3T6
Position
2585557..2586123
Genome map
AA seq 188 aa AA seqDB search
MNKLIIFSAPSGSGKTTIVRHLLSLKKLNLAFSISATSRAPRGEEQHGKEYYFLSADEFK
KRVQHNEFMEWEEVYTGCYYGTLKSEVERLWAKGKNVIFDIDVAGGLRLKQQYPEQTLAV
FVEPPSLIALEERLRNRKTETEEKIQMRLNKAEQEMATAHQFDVIIKNDNLQQALQEAER
IVTDFINR
NT seq 567 nt NT seq  +upstreamnt  +downstreamnt
atgaacaaactaattattttctcagctccttctgggagtggcaaaactaccatagtgagg
catttactctcgctcaaaaaactaaacttagccttttctatttcggctacttctcgtgct
cctcgtggtgaagaacaacacggcaaagaatactatttcctttctgctgatgaattcaaa
aaacgtgttcagcacaacgaatttatggaatgggaagaggtatacacaggttgttattac
ggcacattaaaatcagaagtagaacgcctatgggcaaagggaaagaatgtgatattcgat
attgatgttgcaggaggtctccgtctcaaacaacaatatccagagcaaactttagcagta
tttgttgaaccgccaagccttattgccttagaagaacgcttgcgcaaccgtaagaccgaa
acagaggagaaaatacaaatgcgtctcaacaaagccgaacaagaaatggcaactgctcac
cagtttgatgtgattatcaaaaacgataatctacaacaagccctacaagaggctgagcgc
atagtaaccgattttatcaaccgatga

DBGET integrated database retrieval system