KEGG   Corynebacterium pseudotuberculosis 1/06-A: Cp106_0251Help
Entry
Cp106_0251        CDS       T02052                                 

Gene name
gpmA
Definition
(GenBank) Phosphoglyceromutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
cod  Corynebacterium pseudotuberculosis 1/06-A
Pathway
cod00010  Glycolysis / Gluconeogenesis
cod00260  Glycine, serine and threonine metabolism
cod00680  Methane metabolism
cod01100  Metabolic pathways
cod01110  Biosynthesis of secondary metabolites
cod01120  Microbial metabolism in diverse environments
cod01130  Biosynthesis of antibiotics
cod01200  Carbon metabolism
cod01230  Biosynthesis of amino acids
Module
cod_M00002  Glycolysis, core module involving three-carbon compounds
cod_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:cod00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Cp106_0251 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    Cp106_0251 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Cp106_0251 (gpmA)
Enzymes [BR:cod01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Cp106_0251 (gpmA)
Membrane trafficking [BR:cod04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    Cp106_0251 (gpmA)
Exosome [BR:cod04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Cp106_0251 (gpmA)
  Exosomal proteins of melanoma cells
   Cp106_0251 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: AER68358
Position
263388..264164
Genome map
AA seq 258 aa AA seqDB search
MRNFRGKLSIMTIGKLILLRHGQSEWNASNQFTGWVDVNLTEQGEAEAKRGGEMLKQQDV
LPTVVYTSLLRRAIRTANIALNAADRHWIPVVRDWRLNERHYGALQGLNKAETKDKYGAD
QFMEWRRSYGTPPPELEDSSEFSQANDPRYADLSQVPRTECLKDVVERFVPYFEEEILPR
AKKGETVLIAAHGNSLRALVKHLDNISDADIAELNIPTGIPLVYELDQEGKVLNPGGTYL
DPEAAAAGAAAVAAQGGK
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
gtgagaaattttcgtggcaaactgagcattatgactatcggaaaactgattcttctccgc
cacggacaaagcgagtggaacgcctccaaccagttcacgggttgggtggacgttaacctt
actgagcaaggcgaggccgaggccaagcgcggcggcgagatgctgaagcaacaagatgtt
ttgccaactgttgtctatacttctcttcttcgtcgtgcaatccgcaccgccaacatcgca
cttaacgcggcggatcgtcattggatcccggttgtgcgcgattggcgcctcaacgagcgt
cactatggtgcgttgcagggtctgaacaaggctgagaccaaggataagtatggcgcagat
cagttcatggaatggcgccgttcttacggcacccctcctccggagttggaagactcaagt
gagttttctcaggcaaacgacccccgctacgccgatctgtctcaagttcctcgcacggaa
tgcctcaaggacgttgtagaacgttttgtgccttattttgaagaggaaattttgccacgg
gcgaaaaagggcgagactgtcctcatcgcagcgcatggtaattccttgcgtgcattggtc
aaacaccttgacaatatctcggatgcagatatcgcggagctgaatattcctaccggaatt
ccgctggtatacgagctggaccaggaaggaaaggttcttaacccgggtggtacctacctt
gatccagaggcagcggcagcaggagctgcggcagttgctgcgcaaggcggcaaataa

DBGET integrated database retrieval system