KEGG   Corynebacterium pseudotuberculosis 1/06-A: Cp106_0654Help
Entry
Cp106_0654        CDS       T02052                                 

Gene name
galU
Definition
(GenBank) UTP--glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
cod  Corynebacterium pseudotuberculosis 1/06-A
Pathway
cod00040  Pentose and glucuronate interconversions
cod00052  Galactose metabolism
cod00500  Starch and sucrose metabolism
cod00520  Amino sugar and nucleotide sugar metabolism
cod01100  Metabolic pathways
cod01130  Biosynthesis of antibiotics
Module
cod_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:cod00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Cp106_0654 (galU)
   00052 Galactose metabolism
    Cp106_0654 (galU)
   00500 Starch and sucrose metabolism
    Cp106_0654 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    Cp106_0654 (galU)
Enzymes [BR:cod01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Cp106_0654 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3
Motif
Other DBs
NCBI-ProteinID: AER68738
Position
682652..683581
Genome map
AA seq 309 aa AA seqDB search
MKQPQEAQDSTRVAVKTVIVPAAGMGTRFLPATKTVPKELLPVVDTPGIELIAEEAAQLG
ATRLAVITAPNKQEVMEHFKRFPVLEETLQSRGKTEQYEKVVHASELIAPVSVVQEKPLG
LGHAVGMAESVLDPDEDAVAVMLPDDLVLPRGVVEKMVEVREQLGGSVLCAFEVPEEEVY
NYGVFEIDESAYDGPHHVKKVKGMVEKPSVEEAPSNFVATGRYLLDRAIFDALRRITPGA
GGELQLTDAIDLLIDEGHPVHILVHDGKRHDLGNPGGYIPAVVDFGLRDPAYGPHLKKVL
RKILEEHGA
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgaagcagcctcaagaagctcaagacagtacgcgcgtcgcggtgaagactgtcatcgtt
cctgctgctggcatgggaacgagattccttcctgccacaaaaacggttcctaaagaacta
ttgccagtggtagataccccaggcattgaactgattgcagaagaagcagctcagttgggg
gcaactcgactcgcagtaattacggctcctaataagcaggaagtcatggagcactttaag
cgattcccagtgttggaagagaccctacaaagccggggcaaaaccgaacaatatgaaaaa
gttgttcatgcctctgagcttattgcgccagtttccgtagtgcaggaaaagccgctcggc
cttgggcatgctgttggcatggcggaatcagtccttgatcctgatgaggacgctgtagca
gtcatgcttcccgatgatctagtgcttccgcggggcgtcgtggagaagatggtcgaggta
cgcgagcaactaggcggatctgtgttgtgcgcctttgaagtgccggaggaagaagtctat
aactacggtgtctttgagatcgatgagagtgcatatgatggccctcatcacgtcaaaaaa
gtcaaaggaatggtagaaaaaccctctgtagaagaggctccttcaaattttgtggctacc
ggccgctatttgctcgaccgggctatttttgatgcactccgtagaattaccccgggtgct
ggcggtgagctgcaactcacggatgccattgatttgcttatcgacgaaggccaccctgtg
catattcttgtgcatgacgggaagcgtcatgatcttggcaaccccgggggatacataccg
gctgttgttgattttgggttgcgcgatccagcgtatgggccgcacttaaagaaggtcctc
cgaaagattttggaagaacacggcgcataa

DBGET integrated database retrieval system