KEGG   Corynebacterium pseudotuberculosis 1/06-A: Cp106_1105Help
Entry
Cp106_1105        CDS       T02052                                 

Gene name
coaBC
Definition
(GenBank) Coenzyme A biosynthesis bifunctional protein coaBC (DNA/pantothenate metabolism flavoprotein)
  KO
K13038  phosphopantothenoylcysteine decarboxylase / phosphopantothenate---cysteine ligase [EC:4.1.1.36 6.3.2.5]
Organism
cod  Corynebacterium pseudotuberculosis 1/06-A
Pathway
cod00770  Pantothenate and CoA biosynthesis
cod01100  Metabolic pathways
Module
cod_M00120  Coenzyme A biosynthesis, pantothenate => CoA
Brite
KEGG Orthology (KO) [BR:cod00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    Cp106_1105 (coaBC)
Enzymes [BR:cod01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.36  phosphopantothenoylcysteine decarboxylase
     Cp106_1105 (coaBC)
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.5  phosphopantothenate---cysteine ligase (CTP)
     Cp106_1105 (coaBC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DFP Flavoprotein FlpD
Motif
Other DBs
NCBI-ProteinID: AER69174
Position
complement(1198896..1200149)
Genome map
AA seq 417 aa AA seqDB search
MSRPRKVVVGIAGGVAAYKACHVVRAFKELGDDVRVVPTANALKFIGAATLEALSGNPVT
ASVYDCVDEVQHVNVGKQADLIVIAPATADLLARMAAGRADDLLTATLLVATCPVVVAPA
MHTEMWLHPATQENVRTLRHRGIKVLDPAHGRLTGVDTGPGRLPDPQQIVDLALAVYEGA
DLPRDLENRKVVISAGGTQERIDPVRCITNSSSGRQGFAFAEIAAQRGADVVVVAGCTDE
LPVPLGSRVLRASSARDMHAACMAESVDADIVVMAAAVADYRPVSTAPLKLKKGSADTEL
SHIALVENPDILRSLVEARQEKQINESTVIVGFAAETGDSSHSALDFAREKILRKGCDLL
MCNEVGEGLVFGQARNRGFLLNPSGGYREIPDGSKLCVASTILDAAVKCLDQKRATG
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
gtgtctaggcctcggaaggttgtagtaggtattgctgggggagtcgcagcatataaggct
tgtcatgtagtgcgtgcctttaaagagctgggtgatgatgtgcgagtggtccccactgca
aacgcactaaaattcattggcgctgcgacgttggaagccttgtcaggaaaccccgttacc
gccagcgtttatgactgcgttgatgaggtgcagcatgtgaacgtcggcaagcaagcggat
cttatcgtcatagcacccgctactgcggatcttcttgctcggatggctgcgggacgtgca
gatgatcttcttacagctacgctgttggtcgccacatgtcctgtggtagtggcaccggct
atgcatacggaaatgtggttgcatccggcgacccaagaaaatgttcgtactcttcgacat
cgtgggattaaggttttggatcccgcgcatggtcgtcttacaggcgtagatacaggacct
ggccggttgcctgatcctcaacaaatcgttgacttagcgttagctgtttatgaaggtgct
gacttaccccgggatctggaaaaccgaaaagtggtgatctctgctgggggcacacaagaa
cggattgaccctgtgcgctgtattactaatagctcttcggggcgtcaggggttcgctttt
gcagaaattgcggcacagcgcggggcggatgttgtggtggttgcaggttgtaccgatgaa
ttacctgtgcccttgggttctcgggtgcttcgtgcgtcttctgctcgagatatgcatgca
gcgtgcatggctgaatctgttgatgcggatatcgttgtgatggctgctgcggttgcggat
taccggccggtatctacggcacctttaaaattgaagaaaggctccgctgatactgagtta
tcacatatagctctggtggaaaaccccgatattcttcgatctctcgtggaagcacggcag
gaaaaacaaatcaatgaatcgacggttatcgtgggatttgccgcagaaaccggtgattcc
tcgcatagtgcactcgattttgccagggagaaaatcttgcgtaaaggctgcgatcttttg
atgtgtaacgaggttggtgagggcttggtctttgggcaagcgcgaaaccgaggctttttg
ttaaatccttctggtgggtatcgggagatccccgatggatctaaactttgtgtggcttcg
acaatcctggatgcagcagtgaaatgtcttgatcaaaaacgggcaacgggctaa

DBGET integrated database retrieval system