KEGG   Corynebacterium pseudotuberculosis 1/06-A: Cp106_1237Help
Entry
Cp106_1237        CDS       T02052                                 

Gene name
pgsA1
Definition
(GenBank) Phosphatidylglycerophosphate synthase
  KO
K00995  CDP-diacylglycerol---glycerol-3-phosphate 3-phosphatidyltransferase [EC:2.7.8.5]
Organism
cod  Corynebacterium pseudotuberculosis 1/06-A
Pathway
cod00564  Glycerophospholipid metabolism
cod01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cod00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    Cp106_1237 (pgsA1)
Enzymes [BR:cod01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.8  Transferases for other substituted phosphate groups
    2.7.8.5  CDP-diacylglycerol---glycerol-3-phosphate 1-phosphatidyltransferase
     Cp106_1237 (pgsA1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CDP-OH_P_transf
Motif
Other DBs
NCBI-ProteinID: AER69302
Position
complement(1344114..1344701)
Genome map
AA seq 195 aa AA seqDB search
MNEERTVNTPEHNPSNFNVPNVLTSLRIIVIPLFAWLVISSDGQQASWMWWSLGVFVALM
ITDKLDGDIARAKNLVTDFGKIADPIADKALMITAFVCLNIVGLVGWWVTAIIVVRELGI
TFWRMGELRKGNVVPASRGGKIKTALQSLAVALYLIPLSGFFSVVQFIVLLAAVAITVIT
GVQYLIDARRLNHER
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
gtgaatgaggaacgcactgtcaacacaccggaacataatccttctaattttaatgttcct
aacgtcctgactagtctgcgcatcattgtcatcccattatttgcgtggctcgtcatttca
agcgacggtcagcaggcctcatggatgtggtggagcctcggcgtttttgttgcgctgatg
attacggacaaacttgacggtgatatcgcacgagctaagaatctggtcaccgattttggc
aaaattgcggacccaattgcagataaagcactaatgattacagcttttgtctgcctgaat
attgtgggtctcgtaggatggtgggtcacggctattattgtggttcgtgaattaggcatt
acgttctggcgtatgggagagctgcgtaaaggaaacgtagttccggctagcagaggcggg
aagattaagacagctcttcaatctttggcggtggcgctgtacctgatccctctttctgga
tttttttctgttgttcagttcatcgtgctgctagctgcagtggctattactgttattacg
ggcgtgcagtaccttatcgacgcacgtcgcttgaatcatgagcgatag

DBGET integrated database retrieval system