KEGG   Corynebacterium pseudotuberculosis 1/06-A: Cp106_1550Help
Entry
Cp106_1550        CDS       T02052                                 

Gene name
ndk
Definition
(GenBank) Nucleoside diphosphate kinase
  KO
K00940  nucleoside-diphosphate kinase [EC:2.7.4.6]
Organism
cod  Corynebacterium pseudotuberculosis 1/06-A
Pathway
cod00230  Purine metabolism
cod00240  Pyrimidine metabolism
cod01100  Metabolic pathways
cod01110  Biosynthesis of secondary metabolites
cod01130  Biosynthesis of antibiotics
Module
cod_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
cod_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
cod_M00053  Pyrimidine deoxyribonuleotide biosynthesis, CDP/CTP => dCDP/dCTP,dTDP/dTTP
Brite
KEGG Orthology (KO) [BR:cod00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    Cp106_1550 (ndk)
   00240 Pyrimidine metabolism
    Cp106_1550 (ndk)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cod04131]
    Cp106_1550 (ndk)
Enzymes [BR:cod01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.6  nucleoside-diphosphate kinase
     Cp106_1550 (ndk)
Membrane trafficking [BR:cod04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    Cp106_1550 (ndk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NDK
Motif
Other DBs
NCBI-ProteinID: AER69607
Position
complement(1689425..1689835)
Genome map
AA seq 136 aa AA seqDB search
MSERTLILIKPDGVERGLVGEIIARIERKGLKLSALDLRVADTETAEKHYAEHADKPFFG
ELVKFITSAPLVAGVVEGPRAIEAWRQLAGGTDPVSKATPGTIRGDFALEMSANVVHGSD
SPESAEREIGIWFPNL
NT seq 411 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaacgtaccttgattctgatcaagccggacggcgtcgagcgcgggctggtcgga
gagatcatcgcccgcattgagcgcaaaggccttaagctcagcgcattagatctacgcgtt
gcggatactgagacagctgaaaagcactatgcagagcatgcagataagccattctttggt
gagcttgttaagttcatcacgtccgcacctttagtggccggagttgttgagggaccgcgt
gccattgaggcttggcgtcagctcgccggaggtaccgatcctgtatccaaggctactcct
ggaaccatccgtggggactttgcccttgagatgtcagccaatgttgtccacggctctgat
tcccctgagtccgcagagcgcgagattggtatttggttccccaacctctaa

DBGET integrated database retrieval system