KEGG   Corynebacterium pseudotuberculosis 1/06-A: Cp106_1664Help
Entry
Cp106_1664        CDS       T02052                                 

Gene name
cat1
Definition
(GenBank) Succinyl-CoA Coenzyme A transferase
  KO
K18118  succinyl-CoA:acetate CoA-transferase [EC:2.8.3.18]
Organism
cod  Corynebacterium pseudotuberculosis 1/06-A
Pathway
cod00020  Citrate cycle (TCA cycle)
cod00620  Pyruvate metabolism
cod00650  Butanoate metabolism
cod01100  Metabolic pathways
cod01110  Biosynthesis of secondary metabolites
cod01120  Microbial metabolism in diverse environments
cod01130  Biosynthesis of antibiotics
cod01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cod00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Cp106_1664 (cat1)
   00620 Pyruvate metabolism
    Cp106_1664 (cat1)
   00650 Butanoate metabolism
    Cp106_1664 (cat1)
Enzymes [BR:cod01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.3  CoA-transferases
    2.8.3.18  succinyl-CoA:acetate CoA-transferase
     Cp106_1664 (cat1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AcetylCoA_hyd_C AcetylCoA_hydro CoA_trans
Motif
Other DBs
NCBI-ProteinID: AER69717
Position
complement(1823284..1824789)
Genome map
AA seq 501 aa AA seqDB search
MSDRIANAQLRGKIMSAQEAAQLVDNGDKVGVSGFTGAGYPKVMPAAIAERAKEAQAKGE
SYTIDLFTGASTAPDCDGVLAEAGALRFRMPYQSDPSMRKAINSGNMLYSDIHLSHSGAM
VAEGFFGQLNVAIVEAVRIKEDGSIVPSSSVGNSVEYLDAAEKIIIEVNSWQSEELEGMH
DIWRMPRTPNRIAIPIKNTGDRIGDTSISIDINKVVAVVETDAPDRNAPFKPLDDVSREI
ASNFLGFLEGEVKAGRLDYDRYIMQSGVGNVPNAVMAGLLDSKFENIQAYTEVIQDGMVD
LIDAGKMTVASATSFSLSPEYADKMNENAEFYRKHIVLRPQQISNHPEVIRRTGLIASNG
MIEADIYGNVNSTHVNGVRMMNGIGGSGDFTRNALISTFISPSVAKDGAISAIVPFASHI
DHTEHDVMVLITEYGVADLRGLAPRERVQKAISVAHPDYRPLLEEYFEAAKKATPFMQTP
HDLTQAFSFHHRMNETGTMAK
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atgtctgatcgcattgctaacgcacagttgcggggcaaaattatgtcggcacaagaggcc
gctcagctcgtagataacggtgacaaagtcggtgtctcgggcttcacgggtgccggctac
ccaaaggttatgcctgctgcgatcgccgagcgagcaaaggaagcacaggctaaaggggaa
agctacaccattgacctctttaccggcgcttccaccgcaccggactgcgatggcgtgtta
gcagaagccggagctttgcgtttccgaatgccatatcagtcagaccccagcatgcgtaag
gccattaactcgggcaacatgctgtactccgatatccacctgtctcattcgggcgcgatg
gtagcggaaggcttctttggtcagctgaacgtggctattgttgaggccgttcgtattaaa
gaagacggatcgattgtgccgtcttcctccgtaggaaattccgtggaataccttgatgcg
gcagagaagatcatcatcgaggtcaactcgtggcagtccgaggaacttgagggaatgcac
gacatttggaggatgccgcgtacccccaaccggattgctatccctattaagaacaccggt
gatcgcatcggtgatacctcgatttctattgacatcaacaaggtagtagcagtcgttgag
actgatgctcctgaccgcaacgctccttttaagcctctcgacgacgtctcccgcgagata
gcctcgaacttcttgggcttcctcgaaggggaagttaaagctggtcgactcgactatgat
cgctacatcatgcagtccggcgtaggtaacgttcccaatgccgtgatggcaggcctattg
gactccaagtttgaaaatatccaggcctacaccgaggtcatccaagacggcatggtcgac
ctgatcgatgccggcaagatgaccgttgcttctgccacttcattttcgctgtccccggag
tatgcggacaagatgaatgagaacgcagagttctaccgcaagcacatcgttctgcgtcct
cagcagatctccaaccatcctgaggtgatccgtcgcaccgggttgatcgcttccaacggc
atgatcgaggctgacatttacggcaacgtgaactccacacacgttaatggtgtgcgcatg
atgaacggcatcggaggatccggtgactttacccgtaacgctttgatctccaccttcata
tctccatcggtggctaaggatggcgctatctccgctatcgttccattcgcatctcatatc
gaccacacggagcacgacgtcatggtgctcattacggaatacggtgttgcagacttgcgc
gggcttgcaccacgagagcgtgtgcagaaggccatctccgttgcccacccggattaccgt
cctttgctggaggaatactttgaggcagcaaagaaggcaacgcctttcatgcagaccccg
catgacctcactcaggctttctcattccaccaccgcatgaatgagaccggaacaatggct
aagtaa

DBGET integrated database retrieval system