KEGG   Corynebacterium pseudotuberculosis 1/06-A: Cp106_2019Help
Entry
Cp106_2019        CDS       T02052                                 

Gene name
nanK
Definition
(GenBank) N-acetylglucosamine kinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
cod  Corynebacterium pseudotuberculosis 1/06-A
Pathway
cod00010  Glycolysis / Gluconeogenesis
cod00052  Galactose metabolism
cod00500  Starch and sucrose metabolism
cod00520  Amino sugar and nucleotide sugar metabolism
cod00521  Streptomycin biosynthesis
cod01100  Metabolic pathways
cod01110  Biosynthesis of secondary metabolites
cod01120  Microbial metabolism in diverse environments
cod01130  Biosynthesis of antibiotics
cod01200  Carbon metabolism
Module
cod_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:cod00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Cp106_2019 (nanK)
   00052 Galactose metabolism
    Cp106_2019 (nanK)
   00500 Starch and sucrose metabolism
    Cp106_2019 (nanK)
   00520 Amino sugar and nucleotide sugar metabolism
    Cp106_2019 (nanK)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Cp106_2019 (nanK)
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    Cp106_2019 (nanK)
Enzymes [BR:cod01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Cp106_2019 (nanK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK DUF320
Motif
Other DBs
NCBI-ProteinID: AER70048
Position
complement(2225804..2226739)
Genome map
AA seq 311 aa AA seqDB search
MISAGNKVQTPVRIGVDIGGTKIAAGLVADANPTTVIEYRRRPTPASNVIQEVAGVIQEL
IDVSPTAVSSIGIGAPGVIDPIEGNVVSSGPTMQGWAGTKIADTLREQFPVPVAVHNDVR
VMGLGESIYGAGQDFNNILFVSLGTGVGGALVRDGGLVASPHCTAGELRCLWGRLPDGSA
ALLESFASGPGLAASYNAHAENPAVDLHEIMTRYHAGEEYARGVIEEHLFACGVAIGGFI
SAIDVDAVVVGGGVGNIGDAIINPFARGLKEGAIPPLDAVPVIQAQLGTDAPIVGAAYLG
KTQDQINKVSI
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atgattagcgcaggcaataaagtgcaaacccccgtgcgcatcggcgtggatattggtgga
accaagatcgcggcgggcctggtggcggatgctaaccccaccaccgttattgagtatcgt
cgtcggcctacccccgcgagcaacgtgatacaagaggtcgctggcgttatccaagagctt
atagacgtctcccctactgcggtttcgagcataggaatcggtgctccaggggtcattgat
cccatagaaggcaacgtagtgtcctcggggccgaccatgcagggatgggcgggaactaag
atcgcggatacgctgagggaacaattcccggttcccgttgccgtgcataacgacgtccgc
gttatggggctgggcgagtccatctatggcgctggtcaggactttaacaatattcttttt
gtcagcctgggcactggcgtgggcggggcacttgtgcgtgatggtgggcttgttgcctcg
cctcactgtaccgctggagagctgcgttgcctgtggggacggctccccgatggatctgct
gccctcttagagtccttcgcctctggtcctggactcgctgcctcctataacgcgcatgcg
gagaacccagccgtggatctccacgagattatgactcgataccacgcgggtgaagaatat
gcgcggggtgttattgaggaacatctctttgcctgcggggttgctatcggcgggtttatt
agtgccattgacgtggatgctgtggtggtcggcggtggcgtgggcaatattggcgatgcc
attattaacccctttgctcgtgggctaaaagaaggcgccatccctccactcgatgcagta
ccagttatccaggcacagctaggaaccgatgctcccatcgtgggagccgcatatctgggg
aagacccaagaccaaatcaacaaagtatctatttaa

DBGET integrated database retrieval system