KEGG   Corynebacterium pseudotuberculosis 258: Cp258_0262Help
Entry
Cp258_0262        CDS       T02118                                 

Gene name
gpmA
Definition
(GenBank) Phosphoglyceromutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
coe  Corynebacterium pseudotuberculosis 258
Pathway
coe00010  Glycolysis / Gluconeogenesis
coe00260  Glycine, serine and threonine metabolism
coe00680  Methane metabolism
coe01100  Metabolic pathways
coe01110  Biosynthesis of secondary metabolites
coe01120  Microbial metabolism in diverse environments
coe01130  Biosynthesis of antibiotics
coe01200  Carbon metabolism
coe01230  Biosynthesis of amino acids
Module
coe_M00002  Glycolysis, core module involving three-carbon compounds
coe_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:coe00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Cp258_0262 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    Cp258_0262 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Cp258_0262 (gpmA)
Enzymes [BR:coe01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Cp258_0262 (gpmA)
Membrane trafficking [BR:coe04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    Cp258_0262 (gpmA)
Exosome [BR:coe04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Cp258_0262 (gpmA)
  Exosomal proteins of melanoma cells
   Cp258_0262 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: AFK15909
Position
285382..286158
Genome map
AA seq 258 aa AA seqDB search
MRNFRGKLSIMTIGKLILLRHGQSEWNASNQFTGWVDVNLTEQGEAEAKRGGEMLKQQDV
LPTVVYTSLLRRAIRTANIALNAADRHWIPVVRDWRLNERHYGALQGLNKAETKDKYGAD
QFMEWRRSYGTPPPELEDSSEFSQANDPRYADLSQVPRTECLKDVVERFVPYFEEEILPR
AKKGETVLIAAHGNSLRALVKHLDNISDADIAELNIPTGIPLVYELDQEGKVLNPGGTYL
DPEAAAAGAAAVAAQGGK
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
gtgagaaattttcgtggcaaactgagcattatgactatcggaaaactgattcttctccgc
cacggacaaagcgagtggaacgcctccaaccagttcacgggttgggtggacgttaacctt
actgagcaaggcgaggccgaggccaagcgcggcggcgagatgctgaagcaacaagatgtt
ttgccaactgttgtctatacttctcttcttcgtcgtgcaatccgcaccgccaacatcgca
cttaacgcggcggatcgtcattggatcccggttgtgcgcgattggcgcctcaacgagcgt
cactatggtgcgttgcagggtctgaacaaggctgagaccaaggataagtatggcgcagat
cagttcatggaatggcgccgttcttacggcacccctcctccggagttggaagactcaagt
gagttttctcaggcaaacgacccccgctacgccgatctgtctcaagttcctcgcacggaa
tgcctcaaggacgttgtagaacgttttgtgccttattttgaagaggaaattttgccacgg
gcgaaaaagggcgagactgtcctcatcgcagcgcatggtaattccttgcgtgcattggtc
aaacaccttgacaatatctcggatgcagatatcgcggagctgaatattcctaccggaatt
ccgctggtatacgagctggaccaggaaggaaaggttcttaacccgggtggtacctacctt
gatccagaggcagcggcagcaggagctgcggcagttgctgcgcaaggcggcaaataa

DBGET integrated database retrieval system