KEGG   Corynebacterium pseudotuberculosis 258: Cp258_0787Help
Entry
Cp258_0787        CDS       T02118                                 

Definition
(GenBank) Glycosyl transferase group 2
  KO
K13693  glucosyl-3-phosphoglycerate synthase [EC:2.4.1.266]
Organism
coe  Corynebacterium pseudotuberculosis 258
Brite
KEGG Orthology (KO) [BR:coe00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:coe01003]
    Cp258_0787
Enzymes [BR:coe01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.266  glucosyl-3-phosphoglycerate synthase
     Cp258_0787
Glycosyltransferases [BR:coe01003]
 Others
  Glycosylglycerate
   Cp258_0787
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glycos_transf_2 Glyco_tranf_2_3 Glyco_tranf_2_2 Glyco_transf_21 Glyco_tranf_2_4
Motif
Other DBs
NCBI-ProteinID: AFK16424
Position
854004..854738
Genome map
AA seq 244 aa AA seqDB search
MKISVVIPALNEEATVGEVVRVAANADPWEILVIDSDSTDATAAEARRAGARVINWKEPV
ALPPRLGKGEALWRGTAAATGDVIVFLDADLIEIAPTIVTDLATPLYDPNIHLVKASYQR
AFASSPSGGGRVTELTAKPLLRTLFPELAKVTQPLGGEYAIRSDTARSLPFVDGYGVEVG
LLIDVARLHGPTAIAEVNAGRRAHRNRPLEELAPMADIVTRTILSRAGVLKQRVGERPTL
KSLS
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaatctcggtagtgatccccgcgctcaacgaggaagcgacggtaggagaagttgtg
cgcgtagcagcgaacgcagacccctgggagatcctcgtcattgattcggattccacagat
gcgaccgcggctgaggcgcgccgggcgggtgctcgcgtcattaactggaaagaacctgtg
gcgctgccaccgcgactaggaaaaggggaagcactctggcgaggaacagccgcggctacc
ggtgacgtcattgtattcctagacgccgatttgatagagatcgctccgacgattgtgacc
gacctagcgacgcctttatatgacccgaatatccacttggtcaaagcctcctaccagcgg
gcttttgcttcctctcctagcggtggcgggcgcgtcactgagctgacggcaaagccgctg
ctccgcacattgtttccggagctggcaaaggttactcagccgctaggaggggaatacgcg
attcgctccgacacagctcgcagcctgccctttgttgatggctacggggtggaagtcggg
ttgcttatcgacgtcgcccgtctccatggtccaacggcgatagcagaggtgaacgccggc
aggcgagcccatcgtaatcgacctctggaagagcttgccccaatggccgacatcgtgaca
aggactatcttgagtcgtgccggtgtgctgaagcagcgagtaggagagaggcctacgcta
aagtccctatcctag

DBGET integrated database retrieval system